Notebook Artifact Registry

Computational analysis artifacts linked to analyses and knowledge graph entities

AllAPOE4AgingAllen InstituteAlzheimer'sCRISPRCircuit AnalysisCross-Age AnalysisEpigeneticsGene ExpressionImmune ResponseMicrogliaMouse ModelNeural DynamicsNeurodegenerationNeuroinflammationProtein PropagationSEA-ADSenescent CellsSenolyticsStructural BiologyTauTherapeutics[]agingalzheimersanalysisartifactastrocytesautobiomarkerscell-typescidraftepigeneticsforge-toolsgene-expressionhypothesis-analysisknowledge-gaplipid-raftsmicroglianeurodegenerationneuroinflammationneuronsnotebooksea-adsenescenceshowcasesingle-cellstatisticsstubtauwalkthrough

🌟 Spotlight Notebooks

Mitochondrial Dysfunction as a Driver of Neurodegeneration

How does mitochondrial dysfunction drive neurodegeneration across AD, PD, and ALS? Characterize PINK1/Parkin mitophagy pathway, mtDNA damage, ETC complex activity, and ROS generati

[]
Created: 2026-04-12
View Notebook →

Tau Pathology Propagation in Tauopathies — Mechanistic Dissection

How does misfolded tau spread through the brain in tauopathies? Characterize prion-like propagation mechanisms, cell-to-cell transfer, and the role of MAPT mutations, ApoE genotype

[]
Created: 2026-04-12
View Notebook →

SEA-AD Cell-Type Vulnerability Analysis

Comprehensive single-cell analysis of Alzheimer's disease using Seattle Alzheimer's Disease Brain Cell Atlas data. Includes gene expression heatmaps, differential expression analys

alzheimers single-cell sea-ad cell-types microglia
📊 SEA-AD Single-Cell Analysis: Cell-Type Vulnerability in Alzheimer's Disease
Created: 2026-04-04
View Notebook →

ACSL4-Driven Ferroptotic Priming in Disease-Associated Microglia

Hypothesis ID: h-seaad-v4-26ba859b | Composite Score: 0.82/1.00

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
Created: 2026-04-04
View Notebook →

Cell-Type Specific TREM2 Upregulation in DAM Microglia

Hypothesis ID: h-seaad-51323624 | Composite Score: 0.73/1.00

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
Created: 2026-04-04
View Notebook →

All Notebooks (336)

Protein aggregation cross-seeding across neurodegenerative diseases - Rich Analysis Notebook

Rich analysis notebook with gene expression, pathway enrichment, radar scoring, and statistical tests for Protein aggregation cross-seeding across neurodegenerative diseases.

📊 Protein aggregation cross-seeding across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-16
View Notebook →

Mitochondrial transfer between neurons and glia - Rich Analysis Notebook

Rich analysis notebook with gene expression, pathway enrichment, radar scoring, and statistical tests for Mitochondrial transfer between neurons and glia.

📊 Mitochondrial transfer between neurons and glia (neurodegeneration)
Created: 2026-04-16
View Notebook →

RNA binding protein dysregulation across ALS FTD and AD - Rich Analysis Notebook

Rich analysis notebook with gene expression, pathway enrichment, radar scoring, and statistical tests for RNA binding protein dysregulation across ALS FTD and AD.

📊 RNA binding protein dysregulation across ALS FTD and AD (neurodegeneration)
Created: 2026-04-16
View Notebook →

4R-tau strain-specific spreading patterns in PSP vs CBD - Rich Analysis Notebook

Rich analysis notebook with gene expression, pathway enrichment, radar scoring, and statistical tests for 4R-tau strain-specific spreading patterns in PSP vs CBD.

📊 4R-tau strain-specific spreading patterns in PSP vs CBD (neurodegeneration)
Created: 2026-04-16
View Notebook →

What is the temporal sequence of sleep disruption versus amyloid-beta accumulation in preclinical neurodegeneration? — Analysis Notebook

No description

📊 What is the temporal sequence of sleep disruption versus amyloid-beta accumulation in preclinical neurodegeneration? (neurodegeneration)
Created: 2026-04-12

What are the molecular signatures that distinguish protective vs. harmful microglial states across AD, PD, and ALS? — Analysis Notebook

No description

📊 What are the molecular signatures that distinguish protective vs. harmful microglial states across AD, PD, and ALS? (neurodegeneration)
Created: 2026-04-12

What specific gene expression signatures in aging mouse brain predict human AD vulnerability? — Analysis Notebook

No description

📊 What specific gene expression signatures in aging mouse brain predict human AD vulnerability? (neurodegeneration)
Created: 2026-04-12

Mitochondrial Dysfunction as a Driver of Neurodegeneration

How does mitochondrial dysfunction drive neurodegeneration across AD, PD, and ALS? Characterize PINK1/Parkin mitophagy pathway, mtDNA damage, ETC complex activity, and ROS generation in disease-releva

[]
Created: 2026-04-12
View Notebook →

Tau Pathology Propagation in Tauopathies — Mechanistic Dissection

How does misfolded tau spread through the brain in tauopathies? Characterize prion-like propagation mechanisms, cell-to-cell transfer, and the role of MAPT mutations, ApoE genotype, and GBA in tau spr

[]
Created: 2026-04-12
View Notebook →

What are the optimal timing windows for TREM2 agonism vs antagonism across disease progression stages? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-11-gap-debate-20260410-112636-141592ba. The debate highlighted that TREM2 therapeutic targeting remains contested across disease stages, but no clea

draft auto ci
📊 What are the optimal timing windows for TREM2 agonism vs antagonism across disease progression stages? (neurodegeneration)
Created: 2026-04-12

How can CRISPR systems achieve persistent therapeutic effects while avoiding chronic immune responses to Cas proteins in the CNS? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-11-gap-debate-20260410-112625-c44578b5. The debate highlighted that long-term CRISPR expression triggers immune responses, but epigenetic therapies

draft auto ci
📊 How can CRISPR systems achieve persistent therapeutic effects while avoiding chronic immune responses to Cas proteins in the CNS? (gene therapy)
Created: 2026-04-12

Can P16INK4A expression reliably distinguish harmful from beneficial senescent microglia in neurodegeneration? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-11-gap-debate-20260410-112619-9c3c13d2. The debate proposed P16INK4A-guided targeting but the Skeptic noted microglia exist in complex activation st

draft auto ci
📊 Can P16INK4A expression reliably distinguish harmful from beneficial senescent microglia in neurodegeneration? (neurodegeneration)
Created: 2026-04-12

How can Allen Aging Mouse Brain Atlas data be systematically cross-referenced with human AD datasets to identify conserved vulnerability markers? — Analysis Notebook

No description

📊 How can Allen Aging Mouse Brain Atlas data be systematically cross-referenced with human AD datasets to identify conserved vulnerability markers? (neurodegeneration)
Created: 2026-04-11

What specific gene expression signatures in aging mouse white matter predict human AD vulnerability? — Analysis Notebook

No description

📊 What specific gene expression signatures in aging mouse white matter predict human AD vulnerability? (neurodegeneration)
Created: 2026-04-11

Which specific cell types show greatest vulnerability in AD based on SEA-AD transcriptomic analysis? — Analysis Notebook

No description

📊 Which specific cell types show greatest vulnerability in AD based on SEA-AD transcriptomic analysis? (neurodegeneration)
Created: 2026-04-11

Which neural cell types exhibit the most pronounced gene expression alterations in neurodegeneration? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-11-gap-debate-20260410-112336-ccdef571. The debate generated therapeutic hypotheses targeting different cell types but never resolved the fundamenta

draft auto ci
📊 Which neural cell types exhibit the most pronounced gene expression alterations in neurodegeneration? (neurodegeneration)
Created: 2026-04-11

Does SYK activation provide neuroprotection or exacerbate neuroinflammation in established Alzheimer's disease? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-11-gap-debate-20260410-111113-052488a8. The debate revealed fundamental uncertainty about whether enhancing TYROBP-SYK signaling would be beneficial

draft auto ci
📊 Does SYK activation provide neuroprotection or exacerbate neuroinflammation in established Alzheimer's disease? (neurodegeneration)
Created: 2026-04-11

Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-03-gap-aging-mouse-brain-v2-20260402. What gene expression changes in the aging mouse brain predict neurodegenerative vulnerability? Use Allen Aging

analysis auto ci
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-06
View Notebook →

How do disease-associated mutations in G3BP1 or its binding partners alter stress granule dynamics? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-06-gap-pubmed-20260406-041428-e14e6524. The study establishes G3BP1's role as a tunable switch for stress granule assembly, but doesn't address how

draft auto ci
📊 How do disease-associated mutations in G3BP1 or its binding partners alter stress granule dynamics? (neurodegeneration)
Created: 2026-04-06

Unable to extract research questions - transcript appears to be empty — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-gap-debate-20260403-222510-20260402. The provided transcript contains only speaker labels [Theorist] and [Synthesizer] with no actual debate cont

draft auto ci
📊 Unable to extract research questions - transcript appears to be empty (methodology)
Created: 2026-04-06
View Notebook →

Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-03-gap-aging-mouse-brain-20260402. What gene expression changes in the aging mouse brain predict neurodegenerative vulnerability? Use Allen Aging Mo

analysis auto ci
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-06
View Notebook →

SEA-AD Allen Brain Cell Atlas Analysis

Demonstrates Atlas layer capabilities through analysis of Seattle Alzheimer's Disease Brain Cell Atlas. Includes differential expression, cell type markers, and pathway analysis.

Created: 2026-04-06

TREM2 Gene Expression Analysis in AD

Cell-type specific analysis of TREM2 expression in Alzheimer's disease. Includes statistical testing, effect size analysis, and cross-dataset validation.

Created: 2026-04-06

Pathway Enrichment Analysis for AD Targets

Systematic pathway enrichment analysis of 25 top-scoring hypothesis targets from SciDEX. Identifies 12 significantly enriched pathways including amyloid processing, microglial activation, and lipid me

Created: 2026-04-06

TREM2 Therapeutic Strategy Post-INVOKE-2 — Analysis Notebook

Computational analysis notebook for 'TREM2 Therapeutic Strategy Post-INVOKE-2'. Domain: neurodegeneration. Research question: Analysis question not specified

analysis artifact notebook
📊 TREM2 Therapeutic Strategy Post-INVOKE-2 (neurodegeneration)
Created: 2026-04-04
View Notebook →

What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? — Analysis Notebook

Computational analysis notebook for 'What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis?'. Domain: neurodegeneration. Rese

draft artifact notebook
📊 What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? (neurodegeneration)
Created: 2026-04-04
View Notebook →

SEA-AD Cell-Type Vulnerability Analysis

Comprehensive single-cell analysis of Alzheimer's disease using Seattle Alzheimer's Disease Brain Cell Atlas data. Includes gene expression heatmaps, differential expression analysis, and mechanistic

alzheimers single-cell sea-ad cell-types microglia
TREM2 APOE GFAP MAPT Microglia
📊 SEA-AD Single-Cell Analysis: Cell-Type Vulnerability in Alzheimer's Disease (neurodegeneration)
Created: 2026-04-04
View Notebook →

ACSL4-Driven Ferroptotic Priming in Disease-Associated Microglia

Hypothesis ID: h-seaad-v4-26ba859b | Composite Score: 0.82/1.00

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
Created: 2026-04-04
View Notebook →

Cell-Type Specific TREM2 Upregulation in DAM Microglia

Hypothesis ID: h-seaad-51323624 | Composite Score: 0.73/1.00

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
Created: 2026-04-04
View Notebook →

Proteostasis Enhancement via APOE Chaperone Targeting

Hypothesis ID: h-5d943bfc | Composite Score: 0.74/1.00

gene-expression hypothesis-analysis neurodegeneration statistics
Created: 2026-04-04

APOE-Dependent Autophagy Restoration

Hypothesis ID: h-51e7234f | Composite Score: 0.80/1.00

gene-expression hypothesis-analysis neurodegeneration statistics
Created: 2026-04-04

Targeted Butyrate Supplementation for Microglial Phenotype Modulation

Hypothesis ID: h-3d545f4e | Composite Score: 0.79/1.00

gene-expression hypothesis-analysis microglia neurodegeneration statistics
Created: 2026-04-04

Gamma entrainment therapy to restore hippocampal-cortical synchrony

Hypothesis ID: h-bdbd2120

gene-expression hypothesis-analysis neurodegeneration statistics
Created: 2026-04-04

Aging Mouse Brain Atlas: Cross-Age Gene Expression Analysis

Identify age-related gene expression changes across hippocampus, cortex, and cerebellum to understand aging-neurodegeneration overlap

aging gene-expression neurodegeneration statistics
Created: 2026-04-04
View Notebook →

SEA-AD Gene Expression Analysis: Microglia vs Neurons in Alzheimer's Disease

Notebook ID: SEA-AD-gene-expression-analysis

SEA-AD gene-expression microglia neurodegeneration statistics
Created: 2026-04-04
View Notebook →

SEA-AD Single-Cell Analysis: Cell-Type Vulnerability in Alzheimer's Disease — Analysis Notebook

CI-generated notebook stub for analysis analysis_sea_ad_001. What are the cell-type specific vulnerability mechanisms in Alzheimer's disease based on SEA-AD single-cell data?

analysis auto ci
📊 SEA-AD Single-Cell Analysis: Cell-Type Vulnerability in Alzheimer's Disease (neurodegeneration)
Created: 2026-04-04
View Notebook →

APOE4-driven lipid metabolism dysregulation in astrocytes and its role in AD — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-gap-apoe4-lipid-metabolism. APOE4 is the strongest genetic risk factor for late-onset AD. How APOE4 specifically disrupts lipid homeostasis in as

draft auto ci
📊 APOE4-driven lipid metabolism dysregulation in astrocytes and its role in AD (neuroscience)
Created: 2026-04-04

epigenetic reprogramming aging neurons — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-gap-20260404-060512. epigenetic reprogramming aging neurons

draft auto ci
📊 epigenetic reprogramming aging neurons (neurodegeneration)
Created: 2026-04-04

Investigate prion-like spreading of tau pathology through connected brain regions — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-gap-20260404-052358. Investigate prion-like spreading of tau pathology through connected brain regions

draft auto ci
📊 Investigate prion-like spreading of tau pathology through connected brain regions (neurodegeneration)
Created: 2026-04-04

Astrocyte Reactivity Subtypes in Neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis astrocyte-subtypes. Analysis question not specified

analysis auto ci
📊 Astrocyte Reactivity Subtypes in Neurodegeneration (neurodegeneration)
Created: 2026-04-04
View Notebook →

Neuroinflammation and microglial priming in early Alzheimer's Disease - Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-gap-neuro-microglia-early-ad-20260404. Investigate the role of neuroinflammation and microglial priming in the earliest stages of Alzheimer's Dis

analysis auto ci
📊 Neuroinflammation and microglial priming in early Alzheimer's Disease (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: H 4Bb7Fd8C

Computational notebook for h-4bb7fd8c

Created: 2026-04-04
View Notebook →

Top 5 Analysis: H Bdbd2120

Computational notebook for h-bdbd2120

Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 006

Computational notebook for SDA-2026-04-01-gap-006

SDA
📊 TDP-43 phase separation therapeutics for ALS-FTD (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Hyp Seaad V4 26Ba859B

Computational notebook for hyp-seaad-v4-26ba859b

Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 011 Expression

Computational notebook for SDA-2026-04-01-gap-011-expression

SDA
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 009 Expression

Computational notebook for SDA-2026-04-01-gap-009-expression

SDA
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap V2 691B42F1 Statistics

Computational notebook for SDA-2026-04-01-gap-v2-691b42f1-statistics

SDA
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 01 Gap 010

Computational notebook for SDA-2026-04-01-gap-010

SDA
📊 APOE4 structural biology and therapeutic targeting strategies (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 02 Gap Seaad V4 20260402065846

Computational notebook for SDA-2026-04-02-gap-seaad-v4-20260402065846

SDA
📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Analysis Seaad 20260402

Computational notebook for analysis-SEAAD-20260402

SEAAD
📊 SEA-AD Gene Expression Profiling — Allen Brain Cell Atlas (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 20260401 225155

Computational notebook for SDA-2026-04-01-gap-20260401-225155

SDA
📊 What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 01 Gap 012

Computational notebook for SDA-2026-04-01-gap-012

SDA
📊 Digital biomarkers and AI-driven early detection of neurodegeneration (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap V2 89432B95

Computational notebook for SDA-2026-04-01-gap-v2-89432b95

SDA
📊 Mitochondrial transfer between astrocytes and neurons (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 01 Gap 009

Computational notebook for SDA-2026-04-01-gap-009

SDA
📊 Microglia-astrocyte crosstalk amplification loops in neurodegeneration (neurodegeneration)
Created: 2026-04-04
View Notebook →

Aging Mouse Brain Atlas Analysis

Computational notebook for aging_mouse_brain_atlas_analysis

Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 02 Gap Crispr Neurodegeneration 20260402

Computational notebook for SDA-2026-04-02-gap-crispr-neurodegeneration-20260402

SDA
📊 CRISPR-based therapeutic approaches for neurodegenerative diseases (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Hyp Seaad 51323624

Computational notebook for hyp-seaad-51323624

Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 01 Gap 001

Computational notebook for SDA-2026-04-01-gap-001

SDA
📊 TREM2 agonism vs antagonism in DAM microglia (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap V2 Bc5F270E

Computational notebook for SDA-2026-04-01-gap-v2-bc5f270e

SDA
📊 Epigenetic clocks and biological aging in neurodegeneration (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 02 Gap Aging Mouse Brain 20260402

Computational notebook for SDA-2026-04-02-gap-aging-mouse-brain-20260402

SDA
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 01 Gap 004

Computational notebook for SDA-2026-04-01-gap-004

SDA
📊 Selective vulnerability of entorhinal cortex layer II neurons in AD (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 01 Gap 006

Computational notebook for SDA-2026-04-01-gap-006

SDA
📊 TDP-43 phase separation therapeutics for ALS-FTD (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 01 Gap V2 18Cf98Ca

Computational notebook for SDA-2026-04-01-gap-v2-18cf98ca

SDA
📊 Sleep disruption as cause and consequence of neurodegeneration (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 01 Gap V2 68D9C9C1

Computational notebook for SDA-2026-04-01-gap-v2-68d9c9c1

SDA
📊 RNA binding protein dysregulation across ALS FTD and AD (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 02 Gap Aging Mouse Brain 20260402

Computational notebook for SDA-2026-04-02-gap-aging-mouse-brain-20260402

SDA
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 02 Gap Immune Atlas Neuroinflam 20260402

Computational notebook for SDA-2026-04-02-gap-immune-atlas-neuroinflam-20260402

SDA
📊 Immune atlas neuroinflammation analysis in neurodegeneration (Neuroinflammation)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 02 Gap Ev Ad Biomarkers

Computational notebook for SDA-2026-04-02-gap-ev-ad-biomarkers

SDA
📊 Extracellular vesicle biomarkers for early AD detection (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 01 Gap 007

Computational notebook for SDA-2026-04-01-gap-007

SDA
📊 Astrocyte reactivity subtypes in neurodegeneration (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 02 Gap Seaad V2 20260402032945

Computational notebook for SDA-2026-04-02-gap-seaad-v2-20260402032945

SDA
📊 Cell type vulnerability in Alzheimer's Disease (SEA-AD data - v2) (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: H 4Fabd9Ce

Computational notebook for h-4fabd9ce

Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 004

Computational notebook for SDA-2026-04-01-gap-004

SDA
📊 Selective vulnerability of entorhinal cortex layer II neurons in AD (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 005

Computational notebook for SDA-2026-04-01-gap-005

SDA
📊 4R-tau strain-specific spreading patterns in PSP vs CBD (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 9137255B

Computational notebook for SDA-2026-04-01-gap-9137255b

SDA
📊 Protein aggregation cross-seeding across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 009

Computational notebook for SDA-2026-04-01-gap-009

SDA
📊 Microglia-astrocyte crosstalk amplification loops in neurodegeneration (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 006 Expression

Computational notebook for SDA-2026-04-01-gap-006-expression

SDA
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 02 Gap Aging Mouse Brain V5 20260402

Computational notebook for SDA-2026-04-02-gap-aging-mouse-brain-v5-20260402

SDA
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 01 Gap 013

Computational notebook for SDA-2026-04-01-gap-013

SDA
📊 Senolytic therapy for age-related neurodegeneration (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap V2 18Cf98Ca

Computational notebook for SDA-2026-04-01-gap-v2-18cf98ca

SDA
📊 Sleep disruption as cause and consequence of neurodegeneration (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap V2 18Cf98Ca Statistics

Computational notebook for SDA-2026-04-01-gap-v2-18cf98ca-statistics

SDA
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Hyp 3D545F4E

Computational notebook for hyp-3d545f4e

Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 02 Gap Epigenetic Reprog B685190E

Computational notebook for SDA-2026-04-02-gap-epigenetic-reprog-b685190e

SDA
📊 Epigenetic reprogramming in aging neurons (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 01 Gap 20260401231108

Computational notebook for SDA-2026-04-01-gap-20260401231108

SDA
📊 Mitochondrial transfer between neurons and glia (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 006 Statistics

Computational notebook for SDA-2026-04-01-gap-006-statistics

SDA
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 02 Gap Microglial Subtypes 20260402004119

Computational notebook for SDA-2026-04-02-gap-microglial-subtypes-20260402004119

SDA
📊 Microglial subtypes in neurodegeneration — friend vs foe (neuroscience)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: H 9E9Fee95

Computational notebook for h-9e9fee95

Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 02 26Abc5E5F9F2

Computational notebook for SDA-2026-04-02-26abc5e5f9f2

SDA
📊 Circuit-level neural dynamics in neurodegeneration (neuroscience)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 02 Gap V2 5D0E3052

Computational notebook for SDA-2026-04-02-gap-v2-5d0e3052

SDA
📊 Metabolic reprogramming in neurodegenerative disease (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: H 61196Ade

Computational notebook for h-61196ade

Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 011 Statistics

Computational notebook for SDA-2026-04-01-gap-011-statistics

SDA
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 02 Gap Senescent Clearance Neuro

Computational notebook for SDA-2026-04-02-gap-senescent-clearance-neuro

SDA
📊 Senescent cell clearance as neurodegeneration therapy (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 008

Computational notebook for SDA-2026-04-01-gap-008

SDA
📊 Blood-brain barrier transport mechanisms for antibody therapeutics (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 02 Gap Tau Prop 20260402003221

Computational notebook for SDA-2026-04-02-gap-tau-prop-20260402003221

SDA
📊 Tau propagation mechanisms and therapeutic interception points (neurodegeneration)
Created: 2026-04-04
View Notebook →

Analysis Seaad 20260402

Computational notebook for SEAAD-20260402

SEAAD
📊 Cell type vulnerability in Alzheimer's Disease (SEA-AD data) (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap V2 691B42F1 Expression

Computational notebook for SDA-2026-04-01-gap-v2-691b42f1-expression

SDA
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 02 Gap 20260402 003115

Computational notebook for SDA-2026-04-02-gap-20260402-003115

SDA
📊 Is disrupted sleep a cause or consequence of neurodegeneration? Analyze the bidirectional relationship between sleep disorders (particularly circadian rhythm disruption and impaired glymphatic clearan (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 007

Computational notebook for SDA-2026-04-01-gap-007

SDA
📊 Astrocyte reactivity subtypes in neurodegeneration (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 02 Gap Seaad V3 20260402063622

Computational notebook for SDA-2026-04-02-gap-seaad-v3-20260402063622

SDA
📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 001

Computational notebook for SDA-2026-04-01-gap-001

SDA
📊 TREM2 agonism vs antagonism in DAM microglia (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 02 Gap 001

Computational notebook for SDA-2026-04-02-gap-001

SDA
📊 TREM2 agonism vs antagonism in DAM microglia (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Hyp 51E7234F

Computational notebook for hyp-51e7234f

Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 011

Computational notebook for SDA-2026-04-01-gap-011

SDA
📊 Autophagy-lysosome pathway convergence across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 013

Computational notebook for SDA-2026-04-01-gap-013

SDA
📊 Senolytic therapy for age-related neurodegeneration (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: H 2600483E

Computational notebook for h-2600483e

Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 02 Gap V2 5D0E3052

Computational notebook for SDA-2026-04-02-gap-v2-5d0e3052

SDA
📊 Metabolic reprogramming in neurodegenerative disease (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 009 Statistics

Computational notebook for SDA-2026-04-01-gap-009-statistics

SDA
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 02 Gap Tau Prop 20260402003221

Computational notebook for SDA-2026-04-02-gap-tau-prop-20260402003221

SDA
📊 Tau propagation mechanisms and therapeutic interception points (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 01 Gap V2 691B42F1

Computational notebook for SDA-2026-04-01-gap-v2-691b42f1

SDA
📊 Synaptic pruning by microglia in early AD (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 20260401231108

Computational notebook for SDA-2026-04-01-gap-20260401231108

SDA
📊 Mitochondrial transfer between neurons and glia (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap V2 691B42F1

Computational notebook for SDA-2026-04-01-gap-v2-691b42f1

SDA
📊 Synaptic pruning by microglia in early AD (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Hyp 5D943Bfc

Computational notebook for hyp-5d943bfc

Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 02 Gap Ev Ad Biomarkers

Computational notebook for SDA-2026-04-02-gap-ev-ad-biomarkers

SDA
📊 Extracellular vesicle biomarkers for early AD detection (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap V2 18Cf98Ca Expression

Computational notebook for SDA-2026-04-01-gap-v2-18cf98ca-expression

SDA
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 01 Gap 011

Computational notebook for SDA-2026-04-01-gap-011

SDA
📊 Autophagy-lysosome pathway convergence across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 012

Computational notebook for SDA-2026-04-01-gap-012

SDA
📊 Digital biomarkers and AI-driven early detection of neurodegeneration (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: H De0D4364

Computational notebook for h-de0d4364

Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 02 Gap Aging Mouse Brain V5 20260402

Computational notebook for SDA-2026-04-02-gap-aging-mouse-brain-v5-20260402

SDA
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 02 Gap Tau Propagation 20260402

Computational notebook for SDA-2026-04-02-gap-tau-propagation-20260402

SDA
📊 Tau propagation mechanisms and therapeutic interception points (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 01 Gap 008

Computational notebook for SDA-2026-04-01-gap-008

SDA
📊 Blood-brain barrier transport mechanisms for antibody therapeutics (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 02 Gap 20260402 003058

Computational notebook for SDA-2026-04-02-gap-20260402-003058

SDA
📊 Is disrupted sleep a cause or consequence of neurodegeneration? Analyze the bidirectional relationship between sleep disorders (particularly circadian rhythm disruption and impaired glymphatic clearan (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 01 Gap 005

Computational notebook for SDA-2026-04-01-gap-005

SDA
📊 4R-tau strain-specific spreading patterns in PSP vs CBD (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: H Seaad V4 26Ba859B

Computational notebook for h-seaad-v4-26ba859b

Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 01 Gap Auto Fd6B1635D9

Computational notebook for SDA-2026-04-01-gap-auto-fd6b1635d9

SDA
📊 Mechanistic role of APOE in neurodegeneration (neurodegeneration)
Created: 2026-04-04
View Notebook →

ACSL4-Driven Ferroptotic Priming in Disease-Associated Microglia -- Computational Analysis

Jupyter notebook with gene expression analysis, pathway enrichment, and statistical testing for the ACSL4-Driven Ferroptotic Priming in Disease-Associated Microglia hypothesis (score: 0.82)

ACSL4 GPX4 SLC7A11 TFRC FTH1
📊 View Analysis (science)
Created: 2026-04-03

Circadian Glymphatic Entrainment via Targeted Orexin Receptor Modulation -- Computational Analysis

Jupyter notebook with gene expression analysis, pathway enrichment, and statistical testing for the Circadian Glymphatic Entrainment via Targeted Orexin Receptor Modulation hypothesis (score: 0.825)

HCRTR1 HCRTR2 AQP4 BMAL1 PER2
📊 View Analysis (science)
Created: 2026-04-03

Selective Acid Sphingomyelinase Modulation Therapy -- Computational Analysis

Jupyter notebook with gene expression analysis, pathway enrichment, and statistical testing for the Selective Acid Sphingomyelinase Modulation Therapy hypothesis (score: 0.83)

SMPD1 CERS6 SPHK1 ASAH1 GBA1
📊 View Analysis (science)
Created: 2026-04-03

Cryptic Exon Silencing Restoration -- Computational Analysis

Jupyter notebook with gene expression analysis, pathway enrichment, and statistical testing for the Cryptic Exon Silencing Restoration hypothesis (score: 0.835)

TARDBP UNC13A STMN2 FUS HNRNPA1
📊 View Analysis (science)
Created: 2026-04-03

TREM2-Dependent Microglial Senescence Transition -- Computational Analysis

Jupyter notebook with gene expression analysis, pathway enrichment, and statistical testing for the TREM2-Dependent Microglial Senescence Transition hypothesis (score: 0.85)

TREM2 TYROBP SPI1 CSF1R CX3CR1
📊 View Analysis (science)
Created: 2026-04-03

Gut microbiome dysbiosis and Parkinsons disease -- Rich Analysis Notebook

Gene expression, pathway enrichment, statistical tests for: Gut microbiome dysbiosis and Parkinsons disease

📊 What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? (neurodegeneration)
Created: 2026-04-03
View Notebook →

Perivascular spaces and glymphatic clearance failure in AD -- Rich Analysis Notebook

Gene expression, pathway enrichment, statistical tests for: Perivascular spaces and glymphatic clearance failure in AD

📊 Perivascular spaces and glymphatic clearance failure in AD (neurodegeneration)
Created: 2026-04-03
View Notebook →

Circuit-level neural dynamics in neurodegeneration -- Rich Analysis Notebook

Gene expression, pathway enrichment, statistical tests for: Circuit-level neural dynamics in neurodegeneration

📊 Circuit-level neural dynamics in neurodegeneration (neuroscience)
Created: 2026-04-03
View Notebook →

Lipid raft composition changes in synaptic neurodegeneration -- Rich Analysis Notebook

Comprehensive analysis with gene expression plots, pathway enrichment, statistical tests, and debate highlights for: Lipid raft composition changes in synaptic neurodegeneration

📊 Lipid raft composition changes in synaptic neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

Circuit-level neural dynamics — Analysis Notebook

Comprehensive analysis notebook

BDNF NTRK2 SST PVALB VIP
📊 Circuit-level neural dynamics in neurodegeneration (neuroscience)
Created: 2026-04-03
View Notebook →

Aging mouse brain — Analysis Notebook

Comprehensive analysis notebook

C4B C1QA C1QB C3 GFAP
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-03
View Notebook →

Lipid raft composition — Analysis Notebook

Comprehensive analysis notebook

CYP46A1 SMPD1 ABCA1 LDLR SREBF2
📊 Lipid raft composition changes in synaptic neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

Epigenetic reprogramming — Analysis Notebook

Comprehensive analysis notebook

SIRT1 SIRT3 HDAC3 BRD4 TET2
📊 Epigenetic reprogramming in aging neurons (neurodegeneration)
Created: 2026-04-03
View Notebook →

APOE neurodegeneration — Analysis Notebook

Comprehensive analysis notebook

APOE TREM2 ABCA1 LRP1 CLU
📊 Mechanistic role of APOE in neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

Sleep disruption — Gene Expression

Gene expression for sleep disruption

📊 Sleep disruption as cause and consequence of neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

Sleep disruption — Statistical Deep Dive

Statistical analysis for sleep disruption

📊 Sleep disruption as cause and consequence of neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

Synaptic pruning — Gene Expression

Gene expression for synaptic pruning

📊 Synaptic pruning by microglia in early AD (neurodegeneration)
Created: 2026-04-03
View Notebook →

Synaptic pruning — Statistical Deep Dive

Statistical analysis for synaptic pruning

📊 Synaptic pruning by microglia in early AD (neurodegeneration)
Created: 2026-04-03
View Notebook →

Microglia-astrocyte crosstalk — Gene Expression

Gene expression for glial crosstalk

📊 Microglia-astrocyte crosstalk amplification loops in neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

Microglia-astrocyte crosstalk — Statistical Deep Dive

Statistical analysis for glial crosstalk

📊 Microglia-astrocyte crosstalk amplification loops in neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

Autophagy-lysosome pathway — Gene Expression

Gene expression for autophagy-lysosome

📊 Autophagy-lysosome pathway convergence across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-03
View Notebook →

Autophagy-lysosome pathway — Statistical Deep Dive

Statistical analysis for autophagy-lysosome

📊 Autophagy-lysosome pathway convergence across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-03
View Notebook →

TDP-43 phase separation — Statistical Deep Dive

Statistical analysis for phase separation

📊 TDP-43 phase separation therapeutics for ALS-FTD (neurodegeneration)
Created: 2026-04-03
View Notebook →

TDP-43 phase separation — Gene Expression

Gene expression analysis

TARDBP FUS HNRNPA1
📊 TDP-43 phase separation therapeutics for ALS-FTD (neurodegeneration)
Created: 2026-04-03
View Notebook →

Cell type vulnerability in Alzheimer's Disease (SEA-AD data - v2) - Rich Analysis Notebook

Rich analysis notebook with gene expression, pathway enrichment, radar scoring, and statistical tests for Cell type vulnerability in Alzheimer's Disease (SEA-AD data - v2).

📊 Cell type vulnerability in Alzheimer's Disease (SEA-AD data - v2) (neurodegeneration)
Created: 2026-04-03
View Notebook →

CYP46A1 Overexpression Gene Therapy -- Computational Analysis

Rich computational analysis notebook for hypothesis h-2600483e with gene expression, pathway enrichment, score radar, and statistical analysis.

CYP46A1 BACE1 APP APOE ABCA1
Created: 2026-04-03
View Notebook →

Nutrient-Sensing Epigenetic Circuit Reactivation -- Computational Analysis

Rich computational analysis notebook for hypothesis h-4bb7fd8c with gene expression, pathway enrichment, score radar, and statistical analysis.

SIRT1 NAMPT PGC1A AMPK FOXO3
Created: 2026-04-03
View Notebook →

TREM2 agonism vs antagonism in DAM microglia - Rich Analysis

TREM2/DAM analysis with expression plots, pathway enrichment, hypothesis scoring

📊 TREM2 agonism vs antagonism in DAM microglia (neurodegeneration)
Created: 2026-04-03
View Notebook →

Lipid raft composition changes in synaptic neurodegeneration - Rich Analysis

Rich notebook with gene expression, pathway enrichment, and statistical analysis

SMPD1 ABCA1/LDLR/SREBF2 CYP46A1 ST3GAL2/ST8SIA1 SGMS1/SGMS2
📊 Lipid raft composition changes in synaptic neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

Perivascular spaces and glymphatic clearance failure in AD - Rich Analysis

Rich notebook with gene expression, pathway enrichment, and statistical analysis

HCRTR1/HCRTR2 SDC1 LOX/LOXL1-4 GJA1 PDGFRB
📊 Perivascular spaces and glymphatic clearance failure in AD (neurodegeneration)
Created: 2026-04-03
View Notebook →

Mechanistic role of APOE in neurodegeneration - Rich Analysis

Rich notebook with gene expression, pathway enrichment, and statistical analysis

MTOR HSPA1A TREM2 APOE SPTLC1
📊 Mechanistic role of APOE in neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? - Rich Analysis

Rich notebook with gene expression, pathway enrichment, and statistical analysis

GPR109A TLR4 CHRNA7 CSGA TDC
📊 What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? (neurodegeneration)
Created: 2026-04-03
View Notebook →

RNA binding protein dysregulation across ALS FTD and AD - Rich Analysis

Rich notebook

TARDBP G3BP1 HNRNPA2B1 SETX SYNCRIP
📊 RNA binding protein dysregulation across ALS FTD and AD (neurodegeneration)
Created: 2026-04-03
View Notebook →

TDP-43 phase separation therapeutics for ALS-FTD — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. What are the mechanisms underlying tdp-43 phase separation therapeutics for als-ftd?

📊 TDP-43 phase separation therapeutics for ALS-FTD (neurodegeneration)
Created: 2026-04-03
View Notebook →

Sleep disruption as cause and consequence of neurodegeneration — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. What are the mechanisms underlying sleep disruption as cause and consequence of neurodegeneration?

📊 Sleep disruption as cause and consequence of neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

Synaptic pruning by microglia in early AD — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. What are the mechanisms underlying synaptic pruning by microglia in early ad?

📊 Synaptic pruning by microglia in early AD (neurodegeneration)
Created: 2026-04-03
View Notebook →

Autophagy-lysosome pathway convergence across neurodegenerative diseases — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. What are the mechanisms underlying autophagy-lysosome pathway convergence across neurodegenerative

📊 Autophagy-lysosome pathway convergence across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-03
View Notebook →

Mechanistic role of APOE in neurodegeneration — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. What are the mechanisms underlying mechanistic role of apoe in neurodegeneration?

📊 Mechanistic role of APOE in neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability - Top 5 Rich Notebook

Rich notebook with gene expression, pathway enrichment, KG network, score heatmaps, and statistical analysis.

📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-03
View Notebook →

Lipid raft composition changes in synaptic neurodegeneration - Top 5 Rich Notebook

Rich notebook with gene expression, pathway enrichment, KG network, score heatmaps, and statistical analysis.

📊 Lipid raft composition changes in synaptic neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) - Top 5 Rich Notebook

Rich notebook with gene expression, pathway enrichment, KG network, score heatmaps, and statistical analysis.

📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-03
View Notebook →

Circuit-level neural dynamics in neurodegeneration - Top 5 Rich Notebook

Rich notebook with gene expression, pathway enrichment, KG network, score heatmaps, and statistical analysis.

📊 Circuit-level neural dynamics in neurodegeneration (neuroscience)
Created: 2026-04-03
View Notebook →

Microglia-astrocyte crosstalk amplification loops in neurodegeneration — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. What are the mechanisms underlying microglia-astrocyte crosstalk amplification loops in neurodegen

📊 Microglia-astrocyte crosstalk amplification loops in neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. What are the mechanisms underlying what are the mechanisms by which gut microbiome dysbiosis influ

📊 What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? (neurodegeneration)
Created: 2026-04-03
View Notebook →

Perivascular spaces and glymphatic clearance failure in AD — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. What are the mechanisms underlying perivascular spaces and glymphatic clearance failure in ad?

📊 Perivascular spaces and glymphatic clearance failure in AD (neurodegeneration)
Created: 2026-04-03
View Notebook →

Lipid raft composition changes in synaptic neurodegeneration — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. Investigate how lipid raft composition (cholesterol metabolism, sphingolipids) changes in synaptic

📊 Lipid raft composition changes in synaptic neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

RNA binding protein dysregulation across ALS FTD and AD — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. What are the mechanisms underlying rna binding protein dysregulation across als ftd and ad?

📊 RNA binding protein dysregulation across ALS FTD and AD (neurodegeneration)
Created: 2026-04-03
View Notebook →

Tau propagation mechanisms and therapeutic interception points — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-02-gap-tau-prop-20260402003221: Investigate prion-like spreading of tau pathology through connected brain regions, focusing on trans-synaptic transfer, extrac

📊 Tau propagation mechanisms and therapeutic interception points (neurodegeneration)
Created: 2026-04-03
View Notebook →

Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-02-gap-aging-mouse-brain-20260402: What gene expression changes in the aging mouse brain predict neurodegenerative vulnerability? Use Allen Aging Mouse Brain

📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-03
View Notebook →

Circuit-level neural dynamics in neurodegeneration — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-02-26abc5e5f9f2: Analyze circuit-level changes in neurodegeneration using Allen Institute Neural Dynamics data. Focus on: (1) hippocampal circuit disruption,

📊 Circuit-level neural dynamics in neurodegeneration (neuroscience)
Created: 2026-04-03
View Notebook →

Extracellular vesicle biomarkers for early AD detection — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-02-gap-ev-ad-biomarkers: Extracellular vesicles (EVs), including exosomes and microvesicles, carry molecular cargo (proteins, miRNAs, lipids) from their cells

📊 Extracellular vesicle biomarkers for early AD detection (neurodegeneration)
Created: 2026-04-03
View Notebook →

CRISPR-based therapeutic approaches for neurodegenerative diseases — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-02-gap-crispr-neurodegeneration-20260402: Evaluate the potential of CRISPR/Cas9 and related gene editing technologies for treating neurodegenerative diseases

📊 CRISPR-based therapeutic approaches for neurodegenerative diseases (neurodegeneration)
Created: 2026-04-03
View Notebook →

Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-02-gap-seaad-v3-20260402063622: What cell types are most vulnerable in Alzheimers Disease based on SEA-AD transcriptomic data from the Allen Brain Cell Atlas?

📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-03
View Notebook →

Senescent cell clearance as neurodegeneration therapy — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-02-gap-senescent-clearance-neuro: Senescent cell clearance as neurodegeneration therapy

📊 Senescent cell clearance as neurodegeneration therapy (neurodegeneration)
Created: 2026-04-03
View Notebook →

Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-02-gap-seaad-v4-20260402065846: What cell types are most vulnerable in Alzheimers Disease based on SEA-AD transcriptomic data from the Allen Brain Cell Atlas?

📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-03
View Notebook →

Epigenetic reprogramming in aging neurons — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-02-gap-epigenetic-reprog-b685190e: Investigate mechanisms of epigenetic reprogramming in aging neurons...

📊 Epigenetic reprogramming in aging neurons (neurodegeneration)
Created: 2026-04-03
View Notebook →

Selective vulnerability of entorhinal cortex layer II neurons in AD — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-01-gap-004: What are the mechanisms underlying selective vulnerability of entorhinal cortex layer ii neurons in ad?

📊 Selective vulnerability of entorhinal cortex layer II neurons in AD (neurodegeneration)
Created: 2026-04-03
View Notebook →

4R-tau strain-specific spreading patterns in PSP vs CBD — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-01-gap-005: What are the mechanisms underlying 4r-tau strain-specific spreading patterns in psp vs cbd?

📊 4R-tau strain-specific spreading patterns in PSP vs CBD (neurodegeneration)
Created: 2026-04-03
View Notebook →

Astrocyte reactivity subtypes in neurodegeneration — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-01-gap-007: What are the mechanisms underlying astrocyte reactivity subtypes in neurodegeneration?

📊 Astrocyte reactivity subtypes in neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

Blood-brain barrier transport mechanisms for antibody therapeutics — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-01-gap-008: What are the mechanisms underlying blood-brain barrier transport mechanisms for antibody therapeutics?

📊 Blood-brain barrier transport mechanisms for antibody therapeutics (neurodegeneration)
Created: 2026-04-03
View Notebook →

APOE4 structural biology and therapeutic targeting strategies — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-01-gap-010: What are the mechanisms underlying apoe4 structural biology and therapeutic targeting strategies?

📊 APOE4 structural biology and therapeutic targeting strategies (neurodegeneration)
Created: 2026-04-03
View Notebook →

Digital biomarkers and AI-driven early detection of neurodegeneration — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-01-gap-012: What are the mechanisms underlying digital biomarkers and ai-driven early detection of neurodegeneration?

📊 Digital biomarkers and AI-driven early detection of neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

Senolytic therapy for age-related neurodegeneration — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-01-gap-013: What are the mechanisms underlying senolytic therapy for age-related neurodegeneration?

📊 Senolytic therapy for age-related neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

Neuroinflammation resolution mechanisms and pro-resolving mediators — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-01-gap-014: What are the mechanisms underlying neuroinflammation resolution mechanisms and pro-resolving mediators?

📊 Neuroinflammation resolution mechanisms and pro-resolving mediators (neurodegeneration)
Created: 2026-04-03
View Notebook →

What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-01-gap-20260401-225149: What are the mechanisms underlying what are the mechanisms by which gut microbiome dysbiosis influences parkinson's disease pathogenes

showcase forge-tools walkthrough
📊 What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? (neurodegeneration)
Created: 2026-04-03
View Notebook →

Mitochondrial transfer between neurons and glia — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-01-gap-20260401231108: What are the mechanisms underlying mitochondrial transfer between neurons and glia?

📊 Mitochondrial transfer between neurons and glia (neurodegeneration)
Created: 2026-04-03
View Notebook →

Protein aggregation cross-seeding across neurodegenerative diseases — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-01-gap-9137255b: What are the mechanisms underlying protein aggregation cross-seeding across neurodegenerative diseases?

📊 Protein aggregation cross-seeding across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-03
View Notebook →

Mitochondrial transfer between astrocytes and neurons — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-01-gap-v2-89432b95: What are the mechanisms underlying mitochondrial transfer between astrocytes and neurons?

📊 Mitochondrial transfer between astrocytes and neurons (neurodegeneration)
Created: 2026-04-03
View Notebook →

Epigenetic clocks and biological aging in neurodegeneration — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-01-gap-v2-bc5f270e: What are the mechanisms underlying epigenetic clocks and biological aging in neurodegeneration?

📊 Epigenetic clocks and biological aging in neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) — Rich Analysis Notebook

No description

📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-03
View Notebook →

Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) — Rich Analysis Notebook

No description

📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-03
View Notebook →

Senescent cell clearance as neurodegeneration therapy — Rich Analysis Notebook

No description

📊 Senescent cell clearance as neurodegeneration therapy (neurodegeneration)
Created: 2026-04-03
View Notebook →

Epigenetic reprogramming in aging neurons — Rich Analysis Notebook

No description

📊 Epigenetic reprogramming in aging neurons (neurodegeneration)
Created: 2026-04-03
View Notebook →

Senolytic therapy for age-related neurodegeneration — Executed Analysis Notebook

Rich Jupyter notebook with gene expression heatmap, volcano plot, pathway enrichment, statistical tests, and hypothesis radar chart.

C1Q/C3 CD38/NAMPT AQP4 MMP2/MMP9 GPX4/SLC7A11
📊 Senolytic therapy for age-related neurodegeneration (neurodegeneration)
Created: 2026-04-02
View Notebook →

APOE4 structural biology and therapeutic targeting strategies — Executed Analysis Notebook

Rich Jupyter notebook with gene expression heatmap, volcano plot, pathway enrichment, statistical tests, and hypothesis radar chart.

HSPA1A, HSP90AA1, DNAJB1, FKBP5 APOE APOE APOE APOE
📊 APOE4 structural biology and therapeutic targeting strategies (neurodegeneration)
Created: 2026-04-02
View Notebook →

4R-tau strain-specific spreading patterns in PSP vs CBD — Executed Analysis Notebook

Rich Jupyter notebook with gene expression heatmap, volcano plot, pathway enrichment, statistical tests, and hypothesis radar chart.

P2RY12 CERS2 HSPG2 EPHB4 AQP4
📊 4R-tau strain-specific spreading patterns in PSP vs CBD (neurodegeneration)
Created: 2026-04-02
View Notebook →

Selective vulnerability of entorhinal cortex layer II neurons in AD — Executed Analysis Notebook

Rich Jupyter notebook with gene expression heatmap, volcano plot, pathway enrichment, statistical tests, and hypothesis radar chart.

MAP6 PPARGC1A RELN HCN1 SLC16A2
📊 Selective vulnerability of entorhinal cortex layer II neurons in AD (neurodegeneration)
Created: 2026-04-02
View Notebook →

Metabolic reprogramming in neurodegenerative disease — Executed Analysis Notebook

Rich Jupyter notebook with gene expression heatmap, volcano plot, pathway enrichment, statistical tests, and hypothesis radar chart.

TFEB GLUT3/GLUT4 HMGCS2
📊 Metabolic reprogramming in neurodegenerative disease (neurodegeneration)
Created: 2026-04-02
View Notebook →

Circuit-level neural dynamics in neurodegeneration — Executed Analysis Notebook

Rich Jupyter notebook with gene expression heatmap, volcano plot, pathway enrichment, statistical tests, and hypothesis radar chart for Circuit-level neural dynamics in neurodegeneration.

BDNF SST PVALB
📊 Circuit-level neural dynamics in neurodegeneration (neuroscience)
Created: 2026-04-02
View Notebook →

Tau propagation mechanisms and therapeutic interception points — Executed Analysis Notebook

Rich Jupyter notebook with gene expression heatmap, volcano plot, pathway enrichment, statistical tests, and hypothesis radar chart for Tau propagation mechanisms and therapeutic interception points.

HSP90AA1 TREM2 VCP LRP1 CHMP4B
📊 Tau propagation mechanisms and therapeutic interception points (neurodegeneration)
Created: 2026-04-02
View Notebook →

Epigenetic reprogramming in aging neurons — Executed Analysis Notebook

Rich Jupyter notebook with gene expression heatmap, volcano plot, pathway enrichment, statistical tests, and hypothesis radar chart for Epigenetic reprogramming in aging neurons.

SIRT1 HDAC3 BRD4 HDAC SIRT3
📊 Epigenetic reprogramming in aging neurons (neurodegeneration)
Created: 2026-04-02
View Notebook →

Aging Mouse Brain Atlas: Cross-Age Gene Expression Analysis

Differential expression analysis across hippocampus, cortex, and cerebellum in young, middle-aged, and old mice. Identifies aging-neurodegeneration overlap with 5 testable hypotheses.

Aging Mouse Model Gene Expression Neurodegeneration Cross-Age Analysis
APOE TREM2 GFAP SYP TFAM
Created: 2026-04-02
View Notebook →

SEA-AD Gene Expression Analysis: Microglia vs Neurons

Differential gene expression analysis of Alzheimer's disease-related genes comparing microglia and neurons using Seattle Alzheimer's Disease Brain Cell Atlas (SEA-AD) data. Includes heatmap, volcano p

SEA-AD Allen Institute Alzheimer's Gene Expression Microglia
APP APOE MAPT TREM2 CD33
Created: 2026-04-02
View Notebook →

Is disrupted sleep a cause or consequence of neurodegeneration? Analyze the bidirectional relationship between sleep disorders (particularly circadian rhythm disruption and impaired glymphatic clearan

Analysis ID: SDA-2026-04-02-gap-20260402-003058 Domain: neurodegeneration Hypotheses: 0 KG Edges: 0+

neurodegeneration
📊 Is disrupted sleep a cause or consequence of neurodegeneration? Analyze the bidirectional relationship between sleep disorders (particularly circadian rhythm disruption and impaired glymphatic clearan (neurodegeneration)
Created: 2026-04-02
View Notebook →

Is disrupted sleep a cause or consequence of neurodegeneration? Analyze the bidirectional relationship between sleep disorders (particularly circadian rhythm disruption and impaired glymphatic clearan

Analysis ID: SDA-2026-04-02-gap-20260402-003115 Domain: neurodegeneration Hypotheses: 0 KG Edges: 0+

neurodegeneration
📊 Is disrupted sleep a cause or consequence of neurodegeneration? Analyze the bidirectional relationship between sleep disorders (particularly circadian rhythm disruption and impaired glymphatic clearan (neurodegeneration)
Created: 2026-04-02
View Notebook →

Epigenetic reprogramming in aging neurons

SciDEX Analysis | ID: SDA-2026-04-02-gap-epigenetic-reprog-b685190e

epigenetics neurodegeneration statistics
Created: 2026-04-02
View Notebook →

Immune Atlas: Neuroinflammation in Neurodegeneration

Analysis ID: SDA-2026-04-02-gap-immune-atlas-neuroinflam-20260402 Date: 2026-04-02 Domain: Neuroinflammation

gene-expression microglia neurodegeneration neuroinflammation statistics
📊 Immune atlas neuroinflammation analysis in neurodegeneration (Neuroinflammation)
Created: 2026-04-02
View Notebook →

Microglial Subtypes in Neurodegeneration: Friend vs Foe

Analysis ID: SDA-2026-04-02-gap-microglial-subtypes-20260402004119 Date: 2026-04-02 Domain: Neurodegeneration -- Neuroimmunology

microglia neurodegeneration statistics
📊 Microglial subtypes in neurodegeneration — friend vs foe (neuroscience)
Created: 2026-04-02
View Notebook →

Cell-Type Vulnerability in Alzheimer's Disease — SEA-AD Transcriptomics (v3)

What cell types are most vulnerable in Alzheimer's Disease based on SEA-AD transcriptomic data? Identify differential gene expression, vulnerability scores, and regulatory networks in excitatory neuro

SEA-AD gene-expression microglia neurodegeneration statistics
📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-02
View Notebook →

Cell-Type Vulnerability in Alzheimer's Disease — SEA-AD Transcriptomics (v4)

Extended SEA-AD analysis: identify cell-type-specific gene regulatory networks that predict vulnerability. Focus on super-enhancer-linked genes, TF binding, and cross-cell-type communication in AD-aff

SEA-AD gene-expression microglia neurodegeneration statistics
📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-02
View Notebook →

Tau propagation mechanisms and therapeutic interception points

Analysis ID: SDA-2026-04-02-gap-tau-prop-20260402003221

gene-expression microglia neurodegeneration statistics tau
📊 Tau propagation mechanisms and therapeutic interception points (neurodegeneration)
Created: 2026-04-02
View Notebook →

Tau Propagation Mechanisms and Therapeutic Interception Points

Analysis ID: SDA-2026-04-02-gap-tau-propagation-20260402 Date: 2026-04-02 Domain: Neurodegeneration -- Tauopathies

neurodegeneration statistics tau
📊 Tau propagation mechanisms and therapeutic interception points (neurodegeneration)
Created: 2026-04-02
View Notebook →

Circuit-level neural dynamics in neurodegeneration

Analyze circuit-level changes in neurodegeneration using Allen Institute Neural Dynamics data. Focus on: (1) hippocampal circuit disruption, (2) cortical dynamics alterations, (3) sensory processing c

gene-expression hypothesis-analysis neurodegeneration statistics
📊 Circuit-level neural dynamics in neurodegeneration (neuroscience)
Created: 2026-04-02
View Notebook →

Gene Expression in Aging Mouse Brain Predicting Neurodegeneration (v1)

What gene expression changes in the aging mouse brain predict neurodegenerative vulnerability? Using Allen Brain Atlas aging datasets, identify conserved transcriptomic signatures across 3, 12, 18, an

aging gene-expression hypothesis-analysis neurodegeneration statistics
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-02
View Notebook →

Cellular Senescence Signatures in Aging Mouse Brain (v5)

Which cellular senescence markers in aging mouse brain best predict downstream neurodegeneration risk? Focus on p21/p16 axis, SASP factors, and their interaction with neuroinflammatory cascades.

aging gene-expression hypothesis-analysis microglia neurodegeneration
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-02
View Notebook →

CRISPR-Based Therapeutic Approaches for Neurodegenerative Diseases

Analysis ID: SDA-2026-04-02-gap-crispr-neurodegeneration-20260402 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 5 Knowledge Graph Edges: 15

CRISPR SEA-AD epigenetics gene-expression hypothesis-analysis
📊 CRISPR-based therapeutic approaches for neurodegenerative diseases (neurodegeneration)
Created: 2026-04-02
View Notebook →

Epigenetic Reprogramming in Aging Neurons — Mechanistic Analysis

Investigate mechanisms of epigenetic reprogramming in aging neurons. How do changes in DNA methylation, histone modification, and chromatin remodeling contribute to neurodegeneration risk?

SEA-AD epigenetics gene-expression hypothesis-analysis microglia
📊 Epigenetic reprogramming in aging neurons (neurodegeneration)
Created: 2026-04-02
View Notebook →

Extracellular Vesicle Biomarkers for Early Alzheimer's Disease Detection

Which extracellular vesicle (EV) cargo proteins best discriminate early AD from controls? Characterize EV proteome from plasma, CSF, and brain tissue across disease stages using multi-cohort data.

SEA-AD biomarkers gene-expression hypothesis-analysis microglia
📊 Extracellular vesicle biomarkers for early AD detection (neurodegeneration)
Created: 2026-04-02
View Notebook →

SEA-AD v4: Inhibitory Neuron Subtypes and Circuit Vulnerability in AD

Which inhibitory neuron subtypes show earliest transcriptomic divergence in AD? Characterize Sst, Pvalb, and Vip+ interneuron vulnerability and link to circuit dysfunction biomarkers.

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-02
View Notebook →

Senescent Cell Clearance as Neurodegeneration Therapy

Analysis ID: SDA-2026-04-02-gap-senescent-clearance-neuro Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 5 Knowledge Graph Edges: 15

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Senescent cell clearance as neurodegeneration therapy (neurodegeneration)
Created: 2026-04-02
View Notebook →

Tau propagation mechanisms and therapeutic interception points

Analysis ID: SDA-2026-04-02-gap-tau-prop-20260402003221 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 77

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Tau propagation mechanisms and therapeutic interception points (neurodegeneration)
Created: 2026-04-02
View Notebook →

Metabolic reprogramming in neurodegenerative disease

Analysis ID: SDA-2026-04-02-gap-v2-5d0e3052 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 3 Knowledge Graph Edges: 31

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Metabolic reprogramming in neurodegenerative disease (neurodegeneration)
Created: 2026-04-02
View Notebook →

SEA-AD Gene Expression Profiling — Allen Brain Cell Atlas

Analysis ID: analysis-SEAAD-20260402 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 5 Knowledge Graph Edges: 63

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 SEA-AD Gene Expression Profiling — Allen Brain Cell Atlas (neurodegeneration)
Created: 2026-04-02
View Notebook →

Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) - Rich Analysis Notebook

Enhanced notebook with gene expression, pathway enrichment, and statistical analysis for: What cell types are most vulnerable in Alzheimers Disease based on SEA-AD transcriptomic data from t

📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-02
View Notebook →

Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability - Rich Analysis Notebook

Enhanced notebook with gene expression, pathway enrichment, and statistical analysis for: What gene expression changes in the aging mouse brain predict neurodegenerative vulnerability? Use A

📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-02
View Notebook →

Protein aggregation cross-seeding across neurodegenerative diseases — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. What are the mechanisms underlying protein aggregation cross-seeding across neurodegenerative dise

📊 Protein aggregation cross-seeding across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-02
View Notebook →

SEA-AD Gene Expression Profiling — Allen Brain Cell Atlas — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. What are the cell-type specific expression patterns of key neurodegeneration genes in the Seattle

📊 SEA-AD Gene Expression Profiling — Allen Brain Cell Atlas (neurodegeneration)
Created: 2026-04-02
View Notebook →

What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. What are the mechanisms underlying what are the mechanisms by which gut microbiome dysbiosis influ

showcase forge-tools walkthrough
📊 What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? (neurodegeneration)
Created: 2026-04-02
View Notebook →

Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. What cell types are most vulnerable in Alzheimers Disease based on SEA-AD transcriptomic data from

📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-02
View Notebook →

Mitochondrial transfer between neurons and glia — Rich Analysis Notebook

Comprehensive analysis with gene expression, pathway enrichment, and statistical tests for Mitochondrial transfer between neurons and glia

📊 Mitochondrial transfer between neurons and glia (neurodegeneration)
Created: 2026-04-02
View Notebook →

Digital biomarkers and AI-driven early detection of neurodegeneration — Rich Analysis Notebook

Comprehensive analysis with gene expression, pathway enrichment, and statistical tests for Digital biomarkers and AI-driven early detection of neurodegeneration

📊 Digital biomarkers and AI-driven early detection of neurodegeneration (neurodegeneration)
Created: 2026-04-02
View Notebook →

Blood-brain barrier transport mechanisms for antibody therapeutics — Rich Analysis Notebook

Comprehensive analysis with gene expression, pathway enrichment, and statistical tests for Blood-brain barrier transport mechanisms for antibody therapeutics

📊 Blood-brain barrier transport mechanisms for antibody therapeutics (neurodegeneration)
Created: 2026-04-02
View Notebook →

Astrocyte reactivity subtypes in neurodegeneration — Rich Analysis Notebook

Comprehensive analysis with gene expression, pathway enrichment, and statistical tests for Astrocyte reactivity subtypes in neurodegeneration

📊 Astrocyte reactivity subtypes in neurodegeneration (neurodegeneration)
Created: 2026-04-02
View Notebook →

Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability — Rich Analysis Notebook

Enhanced notebook with gene expression, pathway enrichment, and statistical analysis for: What gene expression changes in the aging mouse brain predict neurodegenerative vulnerability? Use A

📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-02
View Notebook →

Circuit-level neural dynamics in neurodegeneration — Rich Analysis Notebook

Enhanced notebook with gene expression, pathway enrichment, and statistical analysis for: Analyze circuit-level changes in neurodegeneration using Allen Institute Neural Dynamics data. Focus

📊 Circuit-level neural dynamics in neurodegeneration (neuroscience)
Created: 2026-04-02
View Notebook →

Circuit-level neural dynamics in neurodegeneration - Rich Analysis Notebook

Enhanced notebook with gene expression, pathway enrichment, and statistical analysis for: Analyze circuit-level changes in neurodegeneration using Allen Institute Neural Dynamics data. Focus

📊 Circuit-level neural dynamics in neurodegeneration (neuroscience)
Created: 2026-04-02
View Notebook →

CRISPR-Based Therapeutic Approaches for Neurodegenerative Diseases

What is the potential of CRISPR/Cas9 and related gene editing technologies for treating neurodegenerative diseases?

📊 CRISPR-based therapeutic approaches for neurodegenerative diseases (neurodegeneration)
Created: 2026-04-02
View Notebook →

Neuroinflammation Resolution Mechanisms and Pro-Resolving Mediators

How do specialized pro-resolving mediators (SPMs) resolve neuroinflammation, and can their pathways be therapeutically enhanced?

📊 Neuroinflammation resolution mechanisms and pro-resolving mediators (neurodegeneration)
Created: 2026-04-02
View Notebook →

APOE4 Structural Biology and Therapeutic Targeting Strategies

What are the structural mechanisms underlying APOE4 pathogenicity and how can they be exploited for therapeutic intervention?

📊 APOE4 structural biology and therapeutic targeting strategies (neurodegeneration)
Created: 2026-04-02
View Notebook →

CRISPR-based Therapeutic Approaches for Neurodegenerative Diseases — Rich Analysis Notebook

Rich notebook with plots and analysis.

📊 CRISPR-based therapeutic approaches for neurodegenerative diseases (neurodegeneration)
Created: 2026-04-02
View Notebook →

Senescent Cell Clearance as Neurodegeneration Therapy — Rich Analysis Notebook

Rich notebook with plots and analysis.

📊 Senescent cell clearance as neurodegeneration therapy (neurodegeneration)
Created: 2026-04-02
View Notebook →

Cell Type Vulnerability in Alzheimer's Disease (SEA-AD v3) — Rich Analysis Notebook

Rich notebook with plots and analysis.

📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-02
View Notebook →

Epigenetic reprogramming in aging neurons — Rich Analysis Notebook

Rich notebook with gene expression, pathway enrichment, radar scoring, statistical tests.

📊 Epigenetic reprogramming in aging neurons (neurodegeneration)
Created: 2026-04-02
View Notebook →

Selective vulnerability of entorhinal cortex layer II neurons in AD — Rich Analysis Notebook

Rich notebook with gene expression, pathway enrichment, radar scoring, statistical tests.

📊 Selective vulnerability of entorhinal cortex layer II neurons in AD (neurodegeneration)
Created: 2026-04-02
View Notebook →

4R-tau strain-specific spreading patterns in PSP vs CBD — Rich Analysis Notebook

Rich notebook with gene expression, pathway enrichment, radar scoring, statistical tests.

📊 4R-tau strain-specific spreading patterns in PSP vs CBD (neurodegeneration)
Created: 2026-04-02
View Notebook →

Selective Vulnerability of Entorhinal Cortex Layer II Neurons — Multi-Target Analysis

Rich data analysis notebook for: Selective vulnerability of entorhinal cortex layer II neurons in AD. What are the mechanisms underlying selective vulnerability of entorhinal cortex layer ii neurons i

📊 Selective vulnerability of entorhinal cortex layer II neurons in AD (neurodegeneration)
Created: 2026-04-02
View Notebook →

4R-Tau Strain-Specific Spreading Patterns in PSP vs CBD — Comparative Analysis

Rich data analysis notebook for: 4R-tau strain-specific spreading patterns in PSP vs CBD. What are the mechanisms underlying 4r-tau strain-specific spreading patterns in psp vs cbd?

📊 4R-tau strain-specific spreading patterns in PSP vs CBD (neurodegeneration)
Created: 2026-04-02
View Notebook →

Circuit-Level Neural Dynamics — Hippocampal and Cortical Circuits

Analysis of 20 circuit-related genes across CA3/CA1 pyramidal neurons and SST/PV/VIP interneurons. Examines BDNF-NTRK2 signaling, interneuron markers, NMDA receptors, and synaptic gene modules.

BDNF SST PVALB CAMK2A GRIN1
📊 Circuit-level neural dynamics in neurodegeneration (neuroscience)
Created: 2026-04-02
View Notebook →

Senolytic Therapy — SASP, Complement, and NAD+ Mechanisms

Expression analysis of 20 senescence/SASP genes across Senescent Glia, Healthy Glia, Neurons, and Endothelial cells. Validates complement cascade (C1Q/C3), CD38-NAD+ depletion, AQP4 dysregulation, and

C1QA C3 CD38 NAMPT AQP4
📊 Senolytic therapy for age-related neurodegeneration (neurodegeneration)
Created: 2026-04-02
View Notebook →

Astrocyte reactivity subtypes in neurodegeneration — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. What are the mechanisms underlying astrocyte reactivity subtypes in neurodegeneration?

📊 Astrocyte reactivity subtypes in neurodegeneration (neurodegeneration)
Created: 2026-04-02
View Notebook →

Blood-brain barrier transport mechanisms for antibody therapeutics — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. What are the mechanisms underlying blood-brain barrier transport mechanisms for antibody therapeut

📊 Blood-brain barrier transport mechanisms for antibody therapeutics (neurodegeneration)
Created: 2026-04-02
View Notebook →

Digital biomarkers and AI-driven early detection of neurodegeneration — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. What are the mechanisms underlying digital biomarkers and ai-driven early detection of neurodegene

📊 Digital biomarkers and AI-driven early detection of neurodegeneration (neurodegeneration)
Created: 2026-04-02
View Notebook →

Senolytic therapy for age-related neurodegeneration — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. What are the mechanisms underlying senolytic therapy for age-related neurodegeneration?

📊 Senolytic therapy for age-related neurodegeneration (neurodegeneration)
Created: 2026-04-02
View Notebook →

Mitochondrial transfer between neurons and glia — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-01-gap-20260401231108: What are the mechanisms underlying mitochondrial transfer between neurons and glia?

📊 Mitochondrial transfer between neurons and glia (neurodegeneration)
Created: 2026-04-02
View Notebook →

Rich Analysis: Senescent Cell Clearance as Neurodegeneration Therapy

Comprehensive notebook with gene expression, pathway enrichment, and statistical analysis for Senescent Cell Clearance as Neurodegeneration Therapy

📊 Senescent cell clearance as neurodegeneration therapy (neurodegeneration)
Created: 2026-04-02
View Notebook →

Rich Analysis: Cell Type Vulnerability in Alzheimer's Disease — SEA-AD v3

Comprehensive notebook with gene expression, pathway enrichment, and statistical analysis for Cell Type Vulnerability in Alzheimer's Disease — SEA-AD v3

📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-02
View Notebook →

Rich Analysis: Extracellular Vesicle Biomarkers for Early AD Detection

Comprehensive notebook with gene expression, pathway enrichment, and statistical analysis for Extracellular Vesicle Biomarkers for Early AD Detection

📊 Extracellular vesicle biomarkers for early AD detection (neurodegeneration)
Created: 2026-04-02
View Notebook →

Tau propagation mechanisms and therapeutic interception points - Rich Analysis Notebook

Rich analysis notebook with gene expression, pathway enrichment, radar scoring, and statistical tests for Tau propagation mechanisms and therapeutic interception points.

📊 Tau propagation mechanisms and therapeutic interception points (neurodegeneration)
Created: 2026-04-02
View Notebook →

Aging Mouse Brain — Complement Cascade Notebook

Gene expression analysis of complement cascade in aging mouse brain.

📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-02
View Notebook →

Notebook: Cell type vulnerability in Alzheimer's Disease (SEA-AD data - v2)

Auto-generated analysis notebook for SDA-2026-04-02-gap-seaad-v2-20260402032945

📊 Cell type vulnerability in Alzheimer's Disease (SEA-AD data - v2) (neurodegeneration)
Created: 2026-04-02
View Notebook →

Epigenetic reprogramming in aging neurons - Rich Analysis Notebook

Executed notebook with gene expression plots, pathway enrichment, radar charts, and statistical tests for: Investigate mechanisms of epigenetic reprogramming in aging neurons...

📊 Epigenetic reprogramming in aging neurons (neurodegeneration)
Created: 2026-04-02
View Notebook →

Circuit-level neural dynamics in neurodegeneration - Rich Analysis Notebook

Executed notebook with gene expression plots, pathway enrichment, radar charts, and statistical tests for: Analyze circuit-level changes in neurodegeneration using Allen Institute Neural Dynamics data

📊 Circuit-level neural dynamics in neurodegeneration (neuroscience)
Created: 2026-04-02
View Notebook →

Circuit-level neural dynamics in neurodegeneration - Rich Analysis Notebook

Executed notebook with gene expression plots, pathway enrichment, radar charts, and statistical tests for: Analyze circuit-level changes in neurodegeneration using Allen Institute Neural Dynamics data

📊 Circuit-level neural dynamics in neurodegeneration (neuroscience)
Created: 2026-04-02
View Notebook →

Epigenetic clocks and biological aging in neurodegeneration - Rich Analysis Notebook

Enhanced notebook with gene expression, pathway enrichment, and statistical analysis for: What are the mechanisms underlying epigenetic clocks and biological aging in neurodegeneration?

📊 Epigenetic clocks and biological aging in neurodegeneration (neurodegeneration)
Created: 2026-04-02
View Notebook →

Extracellular vesicle biomarkers for early AD detection

Rich Jupyter notebook for Extracellular vesicle biomarkers for early AD detection

📊 Extracellular vesicle biomarkers for early AD detection (neurodegeneration)
Created: 2026-04-02
View Notebook →

Immune atlas neuroinflammation in neurodegeneration - Rich Analysis Notebook

Comprehensive analysis of microglial subtypes (DAM, homeostatic, inflammatory) across AD, PD, ALS. Includes PCA, pathway heatmaps, T-cell infiltration statistics.

📊 Immune atlas neuroinflammation analysis in neurodegeneration (Neuroinflammation)
Created: 2026-04-02
View Notebook →

Tau propagation mechanisms and therapeutic interception - Rich Analysis Notebook

Network diffusion model of tau spread through brain regions. Braak staging simulation, intervention modeling, EV-mediated transfer analysis.

📊 Tau propagation mechanisms and therapeutic interception points (neurodegeneration)
Created: 2026-04-02
View Notebook →

Metabolic reprogramming in neurodegenerative disease - Rich Analysis Notebook

FDG-PET glucose metabolism analysis, metabolic gene expression profiling, therapeutic intervention modeling (ketogenic diet, GLP-1 agonists, metformin).

📊 Metabolic reprogramming in neurodegenerative disease (neurodegeneration)
Created: 2026-04-02
View Notebook →

Microglial subtypes in neurodegeneration friend vs foe - Rich Analysis Notebook

Five-state microglial classification across AD, PD, ALS. t-SNE visualization, protective vs harmful scoring, pharmacological target ranking.

📊 Microglial subtypes in neurodegeneration — friend vs foe (neuroscience)
Created: 2026-04-02
View Notebook →

Mitochondrial transfer between astrocytes and neurons - Rich Analysis Notebook

Enhanced notebook with gene expression, pathway enrichment, and statistical analysis for: What are the mechanisms underlying mitochondrial transfer between astrocytes and neurons?

📊 Mitochondrial transfer between astrocytes and neurons (neurodegeneration)
Created: 2026-04-02
View Notebook →

Senescent cell clearance as neurodegeneration therapy - Analysis Notebook

Gene expression analysis notebook for Can senolytics targeting senescent cells slow neurodegeneration?

Aging Senolytics Therapeutics Senescent Cells
CDKN2A CDKN1A TP53 RB1 BCL2
📊 Senescent cell clearance as neurodegeneration therapy (neurodegeneration)
Created: 2026-04-02
View Notebook →

CRISPR-based therapeutic approaches for neurodegenerative diseases - Analysis Notebook

Gene expression analysis notebook for Which CRISPR approaches are most promising for neurodegeneration?

CAS9 HTT SOD1 APP PSEN1
📊 CRISPR-based therapeutic approaches for neurodegenerative diseases (neurodegeneration)
Created: 2026-04-02
View Notebook →

TREM2 agonism vs antagonism in DAM microglia - Analysis Notebook

Gene expression analysis notebook for Should TREM2 be agonized or antagonized for AD therapy?

TREM2 TYROBP SYK PLCG2 ABI3
📊 TREM2 agonism vs antagonism in DAM microglia (neurodegeneration)
Created: 2026-04-02
View Notebook →

Gene expression changes in aging mouse brain - Analysis Notebook

Gene expression analysis notebook for Which aging gene changes predict neurodegeneration?

GFAP VIM C3 C1QA C1QB
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-02
View Notebook →

Neuroinflammation resolution mechanisms and pro-resolving mediators - Rich Analysis Notebook

Enhanced notebook with gene expression, pathway enrichment, and statistical analysis for: What are the mechanisms underlying neuroinflammation resolution mechanisms and pro-resolving mediato

📊 Neuroinflammation resolution mechanisms and pro-resolving mediators (neurodegeneration)
Created: 2026-04-02
View Notebook →

APOE4 structural biology and therapeutic targeting strategies - Rich Analysis Notebook

Enhanced notebook with gene expression, pathway enrichment, and statistical analysis for: What are the mechanisms underlying apoe4 structural biology and therapeutic targeting strategies?

📊 APOE4 structural biology and therapeutic targeting strategies (neurodegeneration)
Created: 2026-04-02
View Notebook →

Tau propagation mechanisms and therapeutic interception points - Rich Analysis Notebook

Enhanced notebook with gene expression, pathway enrichment, and statistical analysis for: Investigate prion-like spreading of tau pathology through connected brain regions, focusing on trans

Tau Protein Propagation Alzheimer's Therapeutics
📊 Tau propagation mechanisms and therapeutic interception points (neurodegeneration)
Created: 2026-04-02
View Notebook →

Circuit-Level Neural Dynamics in Neurodegeneration

Analyze circuit-level changes in neurodegeneration using Allen Institute Neural Dynamics data. Focus on how ion channel dysfunction and synaptic failure drive progressive circuit collapse in AD, PD, a

Allen Institute Neural Dynamics Circuit Analysis Neurodegeneration
📊 Circuit-level neural dynamics in neurodegeneration (neuroscience)
Created: 2026-04-02
View Notebook →

Epigenetic reprogramming in aging neurons - Rich Analysis Notebook

Executed notebook with gene expression plots, pathway enrichment, radar charts, and statistical tests for: Investigate mechanisms of epigenetic reprogramming in aging neurons...

Aging Epigenetics Gene Expression Neurodegeneration
📊 Epigenetic reprogramming in aging neurons (neurodegeneration)
Created: 2026-04-02
View Notebook →

Neuroinflammation resolution mechanisms and pro-resolving mediators - Rich Analysis Notebook

Enhanced notebook with gene expression, pathway enrichment, and statistical analysis for: What are the mechanisms underlying neuroinflammation resolution mechanisms and pro-resolving mediato

Neuroinflammation Immune Response Therapeutics
📊 Neuroinflammation resolution mechanisms and pro-resolving mediators (neurodegeneration)
Created: 2026-04-02
View Notebook →

APOE4 structural biology and therapeutic targeting strategies - Rich Analysis Notebook

Enhanced notebook with gene expression, pathway enrichment, and statistical analysis for: What are the mechanisms underlying apoe4 structural biology and therapeutic targeting strategies?

APOE4 Structural Biology Therapeutics Alzheimer's
📊 APOE4 structural biology and therapeutic targeting strategies (neurodegeneration)
Created: 2026-04-02
View Notebook →

TREM2 agonism vs antagonism in DAM microglia

Analysis ID: SDA-2026-04-01-gap-001

knowledge-gap microglia neurodegeneration
📊 TREM2 agonism vs antagonism in DAM microglia (neurodegeneration)
Created: 2026-04-01
View Notebook →

Selective vulnerability of entorhinal cortex layer II neurons in AD

Analysis ID: SDA-2026-04-01-gap-004

knowledge-gap neurodegeneration statistics
📊 Selective vulnerability of entorhinal cortex layer II neurons in AD (neurodegeneration)
Created: 2026-04-01
View Notebook →

4R-tau strain-specific spreading patterns in PSP vs CBD

Analysis ID: SDA-2026-04-01-gap-005

knowledge-gap microglia neurodegeneration statistics
📊 4R-tau strain-specific spreading patterns in PSP vs CBD (neurodegeneration)
Created: 2026-04-01
View Notebook →

TDP-43 phase separation therapeutics for ALS-FTD — Gene Expression & Pathway Analysis

Analysis ID: SDA-2026-04-01-gap-006 Date: 2026-04-03 Focus: phase separation dynamics and RNA-protein granule pathology

gene-expression neurodegeneration statistics
📊 TDP-43 phase separation therapeutics for ALS-FTD (neurodegeneration)
Created: 2026-04-01
View Notebook →

TDP-43 phase separation therapeutics for ALS-FTD — Statistical Deep Dive

Analysis ID: SDA-2026-04-01-gap-006 Date: 2026-04-03

gene-expression neurodegeneration statistics
📊 TDP-43 phase separation therapeutics for ALS-FTD (neurodegeneration)
Created: 2026-04-01
View Notebook →

TDP-43 phase separation therapeutics for ALS-FTD

Analysis ID: SDA-2026-04-01-gap-006 Domain: neurodegeneration Status: completed Date: 2026-04-01

neurodegeneration statistics
📊 TDP-43 phase separation therapeutics for ALS-FTD (neurodegeneration)
Created: 2026-04-01
View Notebook →

Astrocyte reactivity subtypes in neurodegeneration

What are the mechanisms underlying astrocyte reactivity subtypes in neurodegeneration?

epigenetics gene-expression neurodegeneration statistics
📊 Astrocyte reactivity subtypes in neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Blood-brain barrier transport mechanisms for antibody therapeutics

What are the mechanisms underlying blood-brain barrier transport mechanisms for antibody therapeutics?

gene-expression neurodegeneration statistics
📊 Blood-brain barrier transport mechanisms for antibody therapeutics (neurodegeneration)
Created: 2026-04-01
View Notebook →

Microglia-astrocyte crosstalk amplification loops in neurodegeneration — Gene Expression & Pathway Analysis

Analysis ID: SDA-2026-04-01-gap-009 Date: 2026-04-03 Focus: glial crosstalk amplification loops in neuroinflammation

gene-expression microglia neurodegeneration neuroinflammation statistics
📊 Microglia-astrocyte crosstalk amplification loops in neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Microglia-astrocyte crosstalk amplification loops in neurodegeneration — Statistical Deep Dive

Analysis ID: SDA-2026-04-01-gap-009 Date: 2026-04-03

gene-expression microglia neurodegeneration neuroinflammation statistics
📊 Microglia-astrocyte crosstalk amplification loops in neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Microglia-astrocyte crosstalk amplification loops in neurodegeneration

What are the mechanisms underlying microglia-astrocyte crosstalk amplification loops in neurodegeneration?

gene-expression microglia neurodegeneration statistics
📊 Microglia-astrocyte crosstalk amplification loops in neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

APOE4 Structural Biology and Therapeutic Targeting Strategies

What are the structural mechanisms underlying APOE4 pathogenicity and how can they be exploited for therapeutic intervention?

gene-expression neurodegeneration statistics
📊 APOE4 structural biology and therapeutic targeting strategies (neurodegeneration)
Created: 2026-04-01
View Notebook →

Autophagy-lysosome pathway convergence across neurodegenerative diseases — Gene Expression & Pathway Analysis

Analysis ID: SDA-2026-04-01-gap-011 Date: 2026-04-03 Focus: autophagy-lysosome convergence across neurodegenerative diseases

gene-expression neurodegeneration statistics
📊 Autophagy-lysosome pathway convergence across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-01
View Notebook →

Autophagy-lysosome pathway convergence across neurodegenerative diseases — Statistical Deep Dive

Analysis ID: SDA-2026-04-01-gap-011 Date: 2026-04-03

gene-expression neurodegeneration statistics
📊 Autophagy-lysosome pathway convergence across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-01
View Notebook →

Autophagy-lysosome pathway convergence across neurodegenerative diseases

What are the mechanisms underlying autophagy-lysosome pathway convergence across neurodegenerative diseases?

gene-expression neurodegeneration statistics
📊 Autophagy-lysosome pathway convergence across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-01
View Notebook →

Digital biomarkers and AI-driven early detection of neurodegeneration

What are the mechanisms underlying digital biomarkers and ai-driven early detection of neurodegeneration?

biomarkers gene-expression neurodegeneration statistics
📊 Digital biomarkers and AI-driven early detection of neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Senolytic therapy for age-related neurodegeneration

What are the mechanisms underlying senolytic therapy for age-related neurodegeneration?

gene-expression neurodegeneration senescence statistics
📊 Senolytic therapy for age-related neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Neuroinflammation Resolution Mechanisms and Pro-Resolving Mediators

How do specialized pro-resolving mediators (SPMs) resolve neuroinflammation, and can their pathways be therapeutically enhanced?

gene-expression microglia neurodegeneration neuroinflammation senescence
📊 Neuroinflammation resolution mechanisms and pro-resolving mediators (neurodegeneration)
Created: 2026-04-01
View Notebook →

Gut Microbiome Dysbiosis and Parkinson's Disease via the Gut-Brain Axis

Real Forge-powered analysis: PubMed search, STRING PPI, Reactome pathways, gene annotations for gut-brain axis / Parkinson's disease research.

showcase forge-tools gene-expression neurodegeneration
📊 What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? (neurodegeneration)
Created: 2026-04-01
View Notebook →

What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis?

What are the mechanisms underlying what are the mechanisms by which gut microbiome dysbiosis influences parkinson's disease pathogenesis through the gut-brain axis??

gene-expression neurodegeneration statistics
📊 What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? (neurodegeneration)
Created: 2026-04-01
View Notebook →

Mitochondrial transfer between neurons and glia

Analysis ID: SDA-2026-04-01-gap-20260401231108

gene-expression microglia neurodegeneration statistics
📊 Mitochondrial transfer between neurons and glia (neurodegeneration)
Created: 2026-04-01
View Notebook →

Protein aggregation cross-seeding across neurodegenerative diseases

What are the mechanisms underlying protein aggregation cross-seeding across neurodegenerative diseases?

gene-expression neurodegeneration statistics
📊 Protein aggregation cross-seeding across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-01
View Notebook →

Mechanistic role of APOE in neurodegeneration

SciDEX Analysis | ID: SDA-2026-04-01-gap-auto-fd6b1635d9

lipid-rafts neurodegeneration statistics
Created: 2026-04-01

Sleep disruption as cause and consequence of neurodegeneration — Gene Expression & Pathway Analysis

Analysis ID: SDA-2026-04-01-gap-v2-18cf98ca Date: 2026-04-03 Focus: bidirectional relationship between sleep disruption and neurodegeneration

gene-expression neurodegeneration statistics
📊 Sleep disruption as cause and consequence of neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Sleep disruption as cause and consequence of neurodegeneration — Statistical Deep Dive

Analysis ID: SDA-2026-04-01-gap-v2-18cf98ca Date: 2026-04-03

gene-expression microglia neurodegeneration statistics tau
📊 Sleep disruption as cause and consequence of neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Sleep Disruption as Cause and Consequence of Neurodegeneration

How do sleep disruptions both drive and result from neurodegenerative disease processes, and what therapeutic opportunities exist in this bidirectional relationship?

gene-expression microglia neurodegeneration statistics tau
📊 Sleep disruption as cause and consequence of neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

RNA binding protein dysregulation across ALS FTD and AD

Analysis ID: SDA-2026-04-01-gap-v2-68d9c9c1

gene-expression neurodegeneration statistics
📊 RNA binding protein dysregulation across ALS FTD and AD (neurodegeneration)
Created: 2026-04-01
View Notebook →

Synaptic pruning by microglia in early AD — Gene Expression & Pathway Analysis

Analysis ID: SDA-2026-04-01-gap-v2-691b42f1 Date: 2026-04-03 Focus: complement-mediated synaptic elimination in early Alzheimer pathology

gene-expression microglia neurodegeneration statistics
📊 Synaptic pruning by microglia in early AD (neurodegeneration)
Created: 2026-04-01
View Notebook →

Synaptic pruning by microglia in early AD — Statistical Deep Dive

Analysis ID: SDA-2026-04-01-gap-v2-691b42f1 Date: 2026-04-03

gene-expression microglia neurodegeneration statistics
📊 Synaptic pruning by microglia in early AD (neurodegeneration)
Created: 2026-04-01
View Notebook →

Synaptic pruning by microglia in early AD

Analysis ID: SDA-2026-04-01-gap-v2-691b42f1

gene-expression microglia neurodegeneration statistics
📊 Synaptic pruning by microglia in early AD (neurodegeneration)
Created: 2026-04-01
View Notebook →

Mitochondrial transfer between astrocytes and neurons

Analysis ID: SDA-2026-04-01-gap-v2-89432b95

gene-expression neurodegeneration
📊 Mitochondrial transfer between astrocytes and neurons (neurodegeneration)
Created: 2026-04-01
View Notebook →

Epigenetic clocks and biological aging in neurodegeneration

What are the mechanisms underlying epigenetic clocks and biological aging in neurodegeneration?

epigenetics gene-expression neurodegeneration statistics
📊 Epigenetic clocks and biological aging in neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Perivascular Spaces and Glymphatic Clearance Failure in AD

How do perivascular space dysfunction and glymphatic clearance failure contribute to Alzheimer's disease pathogenesis?

gene-expression neurodegeneration statistics
📊 Perivascular spaces and glymphatic clearance failure in AD (neurodegeneration)
Created: 2026-04-01
View Notebook →

TREM2 agonism vs antagonism in DAM microglia

Analysis ID: SDA-2026-04-01-gap-001 Date: 2026-04-01 Domain: neurodegeneration Key Hypotheses: - TREM2-Dependent Microglial Senescence Transition (score: 0.705) - Cell-Type Specific TREM

SEA-AD gene-expression hypothesis-analysis knowledge-gap microglia
📊 TREM2 agonism vs antagonism in DAM microglia (neurodegeneration)
Created: 2026-04-01
View Notebook →

Selective vulnerability of entorhinal cortex layer II neurons in AD

Analysis ID: SDA-2026-04-01-gap-004 Date: 2026-04-01 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 83

SEA-AD gene-expression hypothesis-analysis knowledge-gap microglia
📊 Selective vulnerability of entorhinal cortex layer II neurons in AD (neurodegeneration)
Created: 2026-04-01
View Notebook →

4R-tau strain-specific spreading patterns in PSP vs CBD

Analysis ID: SDA-2026-04-01-gap-005 Date: 2026-04-01 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 112

SEA-AD gene-expression hypothesis-analysis knowledge-gap microglia
📊 4R-tau strain-specific spreading patterns in PSP vs CBD (neurodegeneration)
Created: 2026-04-01
View Notebook →

TDP-43 phase separation therapeutics for ALS-FTD

What are the mechanisms underlying tdp-43 phase separation therapeutics for als-ftd?

gene-expression hypothesis-analysis neurodegeneration statistics
📊 TDP-43 phase separation therapeutics for ALS-FTD (neurodegeneration)
Created: 2026-04-01
View Notebook →

Astrocyte reactivity subtypes in neurodegeneration

Analysis ID: SDA-2026-04-01-gap-007 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 20

SEA-AD epigenetics gene-expression hypothesis-analysis microglia
📊 Astrocyte reactivity subtypes in neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Blood-brain barrier transport mechanisms for antibody therapeutics

Analysis ID: SDA-2026-04-01-gap-008 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 20

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Blood-brain barrier transport mechanisms for antibody therapeutics (neurodegeneration)
Created: 2026-04-01
View Notebook →

Microglia-astrocyte crosstalk amplification loops in neurodegeneration

Analysis ID: SDA-2026-04-01-gap-009 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 20

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Microglia-astrocyte crosstalk amplification loops in neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

APOE4 structural biology and therapeutic targeting strategies

Analysis ID: SDA-2026-04-01-gap-010 Date: 2026-04-01 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 81

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 APOE4 structural biology and therapeutic targeting strategies (neurodegeneration)
Created: 2026-04-01
View Notebook →

Autophagy-lysosome pathway convergence across neurodegenerative diseases

What are the mechanisms underlying autophagy-lysosome pathway convergence across neurodegenerative diseases?

gene-expression hypothesis-analysis neurodegeneration statistics
📊 Autophagy-lysosome pathway convergence across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-01
View Notebook →

Digital biomarkers and AI-driven early detection of neurodegeneration

Analysis ID: SDA-2026-04-01-gap-012 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 20

SEA-AD biomarkers gene-expression hypothesis-analysis microglia
📊 Digital biomarkers and AI-driven early detection of neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Senolytic therapy for age-related neurodegeneration

Analysis ID: SDA-2026-04-01-gap-013 Date: 2026-04-01 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 282

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Senolytic therapy for age-related neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis?

What are the mechanisms underlying what are the mechanisms by which gut microbiome dysbiosis influences parkinson's disease pathogenesis through the gut-brain axis??

gene-expression hypothesis-analysis neurodegeneration statistics
📊 What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? (neurodegeneration)
Created: 2026-04-01
View Notebook →

Mitochondrial transfer between neurons and glia

Analysis ID: SDA-2026-04-01-gap-20260401231108 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 0

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Mitochondrial transfer between neurons and glia (neurodegeneration)
Created: 2026-04-01
View Notebook →

Mechanistic role of APOE in neurodegeneration

What are the mechanisms underlying mechanistic role of apoe in neurodegeneration?

gene-expression hypothesis-analysis lipid-rafts neurodegeneration statistics
📊 Mechanistic role of APOE in neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Lipid raft composition changes in synaptic neurodegeneration

Investigate how lipid raft composition (cholesterol metabolism, sphingolipids) changes in synaptic membranes during neurodegeneration and their mechanistic role in amyloid-beta processing and synapse

gene-expression hypothesis-analysis lipid-rafts neurodegeneration statistics
📊 Lipid raft composition changes in synaptic neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Sleep disruption as cause and consequence of neurodegeneration

What are the mechanisms underlying sleep disruption as cause and consequence of neurodegeneration?

gene-expression hypothesis-analysis microglia neurodegeneration statistics
📊 Sleep disruption as cause and consequence of neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

RNA binding protein dysregulation across ALS FTD and AD

What are the mechanisms underlying rna binding protein dysregulation across als ftd and ad?

gene-expression hypothesis-analysis neurodegeneration statistics
📊 RNA binding protein dysregulation across ALS FTD and AD (neurodegeneration)
Created: 2026-04-01
View Notebook →

Synaptic pruning by microglia in early AD

What are the mechanisms underlying synaptic pruning by microglia in early ad?

gene-expression hypothesis-analysis microglia neurodegeneration statistics
📊 Synaptic pruning by microglia in early AD (neurodegeneration)
Created: 2026-04-01
View Notebook →

Perivascular spaces and glymphatic clearance failure in AD

What are the mechanisms underlying perivascular spaces and glymphatic clearance failure in ad?

gene-expression hypothesis-analysis neurodegeneration statistics
📊 Perivascular spaces and glymphatic clearance failure in AD (neurodegeneration)
Created: 2026-04-01
View Notebook →