Notebook Artifact Registry

Computational analysis artifacts linked to analyses and knowledge graph entities

AllAPOE4AgingAllen InstituteAlzheimer'sCRISPRCircuit AnalysisCross-Age AnalysisEpigeneticsGene ExpressionImmune ResponseMicrogliaMouse ModelNeural DynamicsNeurodegenerationNeuroinflammationProtein PropagationSEA-ADSenescent CellsSenolyticsStructural BiologyTauTherapeutics[]agingalzheimersanalysisartifactastrocytesautobiomarkerscell-typescidraftepigeneticsforge-toolsgene-editinggene-expressionhypothesis-analysisknowledge-gaplipid-raftsmicroglianeurodegenerationneuroinflammationneuronsnotebooksea-adseededsenescenceshowcasesingle-cellstatisticsstubtautranscriptomicswalkthrough

🌟 Spotlight Notebooks

Neuroinflammation and Microglial Priming in Early Alzheimer's Disease

Real Forge-powered analysis: PubMed search, STRING PPI, Reactome pathways, gene annotations for microglial priming in early AD.

showcase forge-tools neuroinflammation neurodegeneration
📊 Neuroinflammation and microglial priming in early Alzheimer's Disease
Created: 2026-04-16
View Notebook →

Gene Expression Changes in Aging Mouse Brain Predicting Neurodegenerative Vulnerability

Real Forge-powered analysis: PubMed search, STRING PPI, Reactome pathways, gene annotations for aging mouse brain transcriptomics.

showcase forge-tools transcriptomics neurodegeneration
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability
Created: 2026-04-16
View Notebook →

CRISPR-Based Therapeutic Approaches for Neurodegenerative Diseases

Real Forge-powered analysis: PubMed search, STRING PPI, Reactome pathways, gene annotations for CRISPR neurodegeneration therapy research.

showcase forge-tools gene-editing neurodegeneration
📊 CRISPR-based therapeutic approaches for neurodegenerative diseases
Created: 2026-04-16
View Notebook →

Mitochondrial Dysfunction as a Driver of Neurodegeneration

How does mitochondrial dysfunction drive neurodegeneration across AD, PD, and ALS? Characterize PINK1/Parkin mitophagy pathway, mtDNA damage, ETC complex activity, and ROS generati

[]
Created: 2026-04-12
View Notebook →

Tau Pathology Propagation in Tauopathies — Mechanistic Dissection

How does misfolded tau spread through the brain in tauopathies? Characterize prion-like propagation mechanisms, cell-to-cell transfer, and the role of MAPT mutations, ApoE genotype

[]
Created: 2026-04-12
View Notebook →

All Notebooks (3) (filtered by: Alzheimer's)

SEA-AD Gene Expression Analysis: Microglia vs Neurons

Differential gene expression analysis of Alzheimer's disease-related genes comparing microglia and neurons using Seattle Alzheimer's Disease Brain Cell Atlas (SEA-AD) data. Includes heatmap, volcano p

SEA-AD Allen Institute Alzheimer's Gene Expression Microglia
APP APOE MAPT TREM2 CD33
Created: 2026-04-02
View Notebook →

Tau propagation mechanisms and therapeutic interception points - Rich Analysis Notebook

Enhanced notebook with gene expression, pathway enrichment, and statistical analysis for: Investigate prion-like spreading of tau pathology through connected brain regions, focusing on trans

Tau Protein Propagation Alzheimer's Therapeutics
📊 Tau propagation mechanisms and therapeutic interception points (neurodegeneration)
Created: 2026-04-02
View Notebook →

APOE4 structural biology and therapeutic targeting strategies - Rich Analysis Notebook

Enhanced notebook with gene expression, pathway enrichment, and statistical analysis for: What are the mechanisms underlying apoe4 structural biology and therapeutic targeting strategies?

APOE4 Structural Biology Therapeutics Alzheimer's
📊 APOE4 structural biology and therapeutic targeting strategies (neurodegeneration)
Created: 2026-04-02
View Notebook →