Notebook Artifact Registry

Computational analysis artifacts linked to analyses and knowledge graph entities

AllAPOE4AgingAllen InstituteAlzheimer'sCRISPRCircuit AnalysisCross-Age AnalysisEpigeneticsGene ExpressionImmune ResponseMicrogliaMouse ModelNeural DynamicsNeurodegenerationNeuroinflammationProtein PropagationSEA-ADSenescent CellsSenolyticsStructural BiologyTauTherapeutics[]agingalzheimersanalysisartifactastrocytesautobiomarkerscell-typescidraftepigeneticsforge-toolsgene-editinggene-expressionhypothesis-analysisknowledge-gaplipid-raftsmicroglianeurodegenerationneuroinflammationneuronsnotebooksea-adsenescenceshowcasesingle-cellstatisticsstubtautranscriptomicswalkthrough

🌟 Spotlight Notebooks

Mitochondrial Dysfunction as a Driver of Neurodegeneration

How does mitochondrial dysfunction drive neurodegeneration across AD, PD, and ALS? Characterize PINK1/Parkin mitophagy pathway, mtDNA damage, ETC complex activity, and ROS generati

[]
Created: 2026-04-12
View Notebook →

Tau Pathology Propagation in Tauopathies — Mechanistic Dissection

How does misfolded tau spread through the brain in tauopathies? Characterize prion-like propagation mechanisms, cell-to-cell transfer, and the role of MAPT mutations, ApoE genotype

[]
Created: 2026-04-12
View Notebook →

Neuroinflammation and microglial priming in early Alzheimer's Disease — Analysis Notebook

Mechanistic links between early microglial priming states, neuroinflammatory signaling, and AD progression. Forge-powered analysis with 14 hypotheses, 105 KG edges, and PubMed cita

showcase forge-tools neuroinflammation neurodegeneration
📊 Neuroinflammation and microglial priming in early Alzheimer's Disease
Created: 2026-04-11
View Notebook →

Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability — Analysis Notebook

Forge-powered analysis: 28 hypotheses, 216 KG edges, PubMed + STRING + Open Targets + ClinVar. 10 code cells, 5 plots.

showcase forge-tools transcriptomics neurodegeneration
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability
Created: 2026-04-11
View Notebook →

CRISPR-based therapeutic approaches for neurodegenerative diseases — Analysis Notebook

CRISPR-based therapeutic approaches for neurodegenerative diseases (Alzheimer, Parkinson, Huntington). Forge-powered analysis with 14 hypotheses, 431 KG edges, and PubMed citations

showcase forge-tools gene-editing neurodegeneration
📊 CRISPR-based therapeutic approaches for neurodegenerative diseases
Created: 2026-04-11
View Notebook →

All Notebooks (44) (filtered by: Microglia)

SEA-AD Cell-Type Vulnerability Analysis

Comprehensive single-cell analysis of Alzheimer's disease using Seattle Alzheimer's Disease Brain Cell Atlas data. Includes gene expression heatmaps, differential expression analysis, and mechanistic

alzheimers single-cell sea-ad cell-types microglia
TREM2 APOE GFAP MAPT Microglia
📊 SEA-AD Single-Cell Analysis: Cell-Type Vulnerability in Alzheimer's Disease (neurodegeneration)
Created: 2026-04-04
View Notebook →

ACSL4-Driven Ferroptotic Priming in Disease-Associated Microglia

Hypothesis ID: h-seaad-v4-26ba859b | Composite Score: 0.82/1.00

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
Created: 2026-04-04
View Notebook →

Cell-Type Specific TREM2 Upregulation in DAM Microglia

Hypothesis ID: h-seaad-51323624 | Composite Score: 0.73/1.00

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
Created: 2026-04-04
View Notebook →

Targeted Butyrate Supplementation for Microglial Phenotype Modulation

Hypothesis ID: h-3d545f4e | Composite Score: 0.79/1.00

gene-expression hypothesis-analysis microglia neurodegeneration statistics
Created: 2026-04-04

SEA-AD Gene Expression Analysis: Microglia vs Neurons in Alzheimer's Disease

Notebook ID: SEA-AD-gene-expression-analysis

SEA-AD gene-expression microglia neurodegeneration statistics
Created: 2026-04-04
View Notebook →

SEA-AD Gene Expression Analysis: Microglia vs Neurons

Differential gene expression analysis of Alzheimer's disease-related genes comparing microglia and neurons using Seattle Alzheimer's Disease Brain Cell Atlas (SEA-AD) data. Includes heatmap, volcano p

SEA-AD Allen Institute Alzheimer's Gene Expression Microglia
APP APOE MAPT TREM2 CD33
Created: 2026-04-02
View Notebook →

Immune Atlas: Neuroinflammation in Neurodegeneration

Analysis ID: SDA-2026-04-02-gap-immune-atlas-neuroinflam-20260402 Date: 2026-04-02 Domain: Neuroinflammation

gene-expression microglia neurodegeneration neuroinflammation statistics
📊 Immune atlas neuroinflammation analysis in neurodegeneration (Neuroinflammation)
Created: 2026-04-02
View Notebook →

Microglial Subtypes in Neurodegeneration: Friend vs Foe

Analysis ID: SDA-2026-04-02-gap-microglial-subtypes-20260402004119 Date: 2026-04-02 Domain: Neurodegeneration -- Neuroimmunology

microglia neurodegeneration statistics
📊 Microglial subtypes in neurodegeneration — friend vs foe (neuroscience)
Created: 2026-04-02
View Notebook →

Cell-Type Vulnerability in Alzheimer's Disease — SEA-AD Transcriptomics (v3)

What cell types are most vulnerable in Alzheimer's Disease based on SEA-AD transcriptomic data? Identify differential gene expression, vulnerability scores, and regulatory networks in excitatory neuro

SEA-AD gene-expression microglia neurodegeneration statistics
📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-02
View Notebook →

Cell-Type Vulnerability in Alzheimer's Disease — SEA-AD Transcriptomics (v4)

Extended SEA-AD analysis: identify cell-type-specific gene regulatory networks that predict vulnerability. Focus on super-enhancer-linked genes, TF binding, and cross-cell-type communication in AD-aff

SEA-AD gene-expression microglia neurodegeneration statistics
📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-02
View Notebook →

Tau propagation mechanisms and therapeutic interception points

Analysis ID: SDA-2026-04-02-gap-tau-prop-20260402003221

gene-expression microglia neurodegeneration statistics tau
📊 Tau propagation mechanisms and therapeutic interception points (neurodegeneration)
Created: 2026-04-02
View Notebook →

Cellular Senescence Signatures in Aging Mouse Brain (v5)

Which cellular senescence markers in aging mouse brain best predict downstream neurodegeneration risk? Focus on p21/p16 axis, SASP factors, and their interaction with neuroinflammatory cascades.

aging gene-expression hypothesis-analysis microglia neurodegeneration
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-02
View Notebook →

CRISPR-Based Therapeutic Approaches for Neurodegenerative Diseases

Analysis ID: SDA-2026-04-02-gap-crispr-neurodegeneration-20260402 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 5 Knowledge Graph Edges: 15

CRISPR SEA-AD epigenetics gene-expression hypothesis-analysis
📊 CRISPR-based therapeutic approaches for neurodegenerative diseases (neurodegeneration)
Created: 2026-04-02
View Notebook →

Epigenetic Reprogramming in Aging Neurons — Mechanistic Analysis

Investigate mechanisms of epigenetic reprogramming in aging neurons. How do changes in DNA methylation, histone modification, and chromatin remodeling contribute to neurodegeneration risk?

SEA-AD epigenetics gene-expression hypothesis-analysis microglia
📊 Epigenetic reprogramming in aging neurons (neurodegeneration)
Created: 2026-04-02
View Notebook →

Extracellular Vesicle Biomarkers for Early Alzheimer's Disease Detection

Which extracellular vesicle (EV) cargo proteins best discriminate early AD from controls? Characterize EV proteome from plasma, CSF, and brain tissue across disease stages using multi-cohort data.

SEA-AD biomarkers gene-expression hypothesis-analysis microglia
📊 Extracellular vesicle biomarkers for early AD detection (neurodegeneration)
Created: 2026-04-02
View Notebook →

SEA-AD v4: Inhibitory Neuron Subtypes and Circuit Vulnerability in AD

Which inhibitory neuron subtypes show earliest transcriptomic divergence in AD? Characterize Sst, Pvalb, and Vip+ interneuron vulnerability and link to circuit dysfunction biomarkers.

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-02
View Notebook →

Senescent Cell Clearance as Neurodegeneration Therapy

Analysis ID: SDA-2026-04-02-gap-senescent-clearance-neuro Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 5 Knowledge Graph Edges: 15

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Senescent cell clearance as neurodegeneration therapy (neurodegeneration)
Created: 2026-04-02
View Notebook →

Tau propagation mechanisms and therapeutic interception points

Analysis ID: SDA-2026-04-02-gap-tau-prop-20260402003221 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 77

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Tau propagation mechanisms and therapeutic interception points (neurodegeneration)
Created: 2026-04-02
View Notebook →

Metabolic reprogramming in neurodegenerative disease

Analysis ID: SDA-2026-04-02-gap-v2-5d0e3052 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 3 Knowledge Graph Edges: 31

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Metabolic reprogramming in neurodegenerative disease (neurodegeneration)
Created: 2026-04-02
View Notebook →

SEA-AD Gene Expression Profiling — Allen Brain Cell Atlas

Analysis ID: analysis-SEAAD-20260402 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 5 Knowledge Graph Edges: 63

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 SEA-AD Gene Expression Profiling — Allen Brain Cell Atlas (neurodegeneration)
Created: 2026-04-02
View Notebook →

TREM2 agonism vs antagonism in DAM microglia

Analysis ID: SDA-2026-04-01-gap-001

knowledge-gap microglia neurodegeneration
📊 TREM2 agonism vs antagonism in DAM microglia (neurodegeneration)
Created: 2026-04-01
View Notebook →

4R-tau strain-specific spreading patterns in PSP vs CBD

Analysis ID: SDA-2026-04-01-gap-005

knowledge-gap microglia neurodegeneration statistics
📊 4R-tau strain-specific spreading patterns in PSP vs CBD (neurodegeneration)
Created: 2026-04-01
View Notebook →

Microglia-astrocyte crosstalk amplification loops in neurodegeneration — Gene Expression & Pathway Analysis

Analysis ID: SDA-2026-04-01-gap-009 Date: 2026-04-03 Focus: glial crosstalk amplification loops in neuroinflammation

gene-expression microglia neurodegeneration neuroinflammation statistics
📊 Microglia-astrocyte crosstalk amplification loops in neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Microglia-astrocyte crosstalk amplification loops in neurodegeneration — Statistical Deep Dive

Analysis ID: SDA-2026-04-01-gap-009 Date: 2026-04-03

gene-expression microglia neurodegeneration neuroinflammation statistics
📊 Microglia-astrocyte crosstalk amplification loops in neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Microglia-astrocyte crosstalk amplification loops in neurodegeneration

What are the mechanisms underlying microglia-astrocyte crosstalk amplification loops in neurodegeneration?

gene-expression microglia neurodegeneration statistics
📊 Microglia-astrocyte crosstalk amplification loops in neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Neuroinflammation Resolution Mechanisms and Pro-Resolving Mediators

How do specialized pro-resolving mediators (SPMs) resolve neuroinflammation, and can their pathways be therapeutically enhanced?

gene-expression microglia neurodegeneration neuroinflammation senescence
📊 Neuroinflammation resolution mechanisms and pro-resolving mediators (neurodegeneration)
Created: 2026-04-01
View Notebook →

Mitochondrial transfer between neurons and glia

Analysis ID: SDA-2026-04-01-gap-20260401231108

gene-expression microglia neurodegeneration statistics
📊 Mitochondrial transfer between neurons and glia (neurodegeneration)
Created: 2026-04-01
View Notebook →

Sleep disruption as cause and consequence of neurodegeneration — Statistical Deep Dive

Analysis ID: SDA-2026-04-01-gap-v2-18cf98ca Date: 2026-04-03

gene-expression microglia neurodegeneration statistics tau
📊 Sleep disruption as cause and consequence of neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Sleep Disruption as Cause and Consequence of Neurodegeneration

How do sleep disruptions both drive and result from neurodegenerative disease processes, and what therapeutic opportunities exist in this bidirectional relationship?

gene-expression microglia neurodegeneration statistics tau
📊 Sleep disruption as cause and consequence of neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Synaptic pruning by microglia in early AD — Gene Expression & Pathway Analysis

Analysis ID: SDA-2026-04-01-gap-v2-691b42f1 Date: 2026-04-03 Focus: complement-mediated synaptic elimination in early Alzheimer pathology

gene-expression microglia neurodegeneration statistics
📊 Synaptic pruning by microglia in early AD (neurodegeneration)
Created: 2026-04-01
View Notebook →

Synaptic pruning by microglia in early AD — Statistical Deep Dive

Analysis ID: SDA-2026-04-01-gap-v2-691b42f1 Date: 2026-04-03

gene-expression microglia neurodegeneration statistics
📊 Synaptic pruning by microglia in early AD (neurodegeneration)
Created: 2026-04-01
View Notebook →

Synaptic pruning by microglia in early AD

Analysis ID: SDA-2026-04-01-gap-v2-691b42f1

gene-expression microglia neurodegeneration statistics
📊 Synaptic pruning by microglia in early AD (neurodegeneration)
Created: 2026-04-01
View Notebook →

TREM2 agonism vs antagonism in DAM microglia

Analysis ID: SDA-2026-04-01-gap-001 Date: 2026-04-01 Domain: neurodegeneration Key Hypotheses: - TREM2-Dependent Microglial Senescence Transition (score: 0.705) - Cell-Type Specific TREM

SEA-AD gene-expression hypothesis-analysis knowledge-gap microglia
📊 TREM2 agonism vs antagonism in DAM microglia (neurodegeneration)
Created: 2026-04-01
View Notebook →

Selective vulnerability of entorhinal cortex layer II neurons in AD

Analysis ID: SDA-2026-04-01-gap-004 Date: 2026-04-01 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 83

SEA-AD gene-expression hypothesis-analysis knowledge-gap microglia
📊 Selective vulnerability of entorhinal cortex layer II neurons in AD (neurodegeneration)
Created: 2026-04-01
View Notebook →

4R-tau strain-specific spreading patterns in PSP vs CBD

Analysis ID: SDA-2026-04-01-gap-005 Date: 2026-04-01 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 112

SEA-AD gene-expression hypothesis-analysis knowledge-gap microglia
📊 4R-tau strain-specific spreading patterns in PSP vs CBD (neurodegeneration)
Created: 2026-04-01
View Notebook →

Astrocyte reactivity subtypes in neurodegeneration

Analysis ID: SDA-2026-04-01-gap-007 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 20

SEA-AD epigenetics gene-expression hypothesis-analysis microglia
📊 Astrocyte reactivity subtypes in neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Blood-brain barrier transport mechanisms for antibody therapeutics

Analysis ID: SDA-2026-04-01-gap-008 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 20

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Blood-brain barrier transport mechanisms for antibody therapeutics (neurodegeneration)
Created: 2026-04-01
View Notebook →

Microglia-astrocyte crosstalk amplification loops in neurodegeneration

Analysis ID: SDA-2026-04-01-gap-009 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 20

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Microglia-astrocyte crosstalk amplification loops in neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

APOE4 structural biology and therapeutic targeting strategies

Analysis ID: SDA-2026-04-01-gap-010 Date: 2026-04-01 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 81

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 APOE4 structural biology and therapeutic targeting strategies (neurodegeneration)
Created: 2026-04-01
View Notebook →

Digital biomarkers and AI-driven early detection of neurodegeneration

Analysis ID: SDA-2026-04-01-gap-012 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 20

SEA-AD biomarkers gene-expression hypothesis-analysis microglia
📊 Digital biomarkers and AI-driven early detection of neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Senolytic therapy for age-related neurodegeneration

Analysis ID: SDA-2026-04-01-gap-013 Date: 2026-04-01 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 282

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Senolytic therapy for age-related neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Mitochondrial transfer between neurons and glia

Analysis ID: SDA-2026-04-01-gap-20260401231108 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 0

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Mitochondrial transfer between neurons and glia (neurodegeneration)
Created: 2026-04-01
View Notebook →

Sleep disruption as cause and consequence of neurodegeneration

What are the mechanisms underlying sleep disruption as cause and consequence of neurodegeneration?

gene-expression hypothesis-analysis microglia neurodegeneration statistics
📊 Sleep disruption as cause and consequence of neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Synaptic pruning by microglia in early AD

What are the mechanisms underlying synaptic pruning by microglia in early ad?

gene-expression hypothesis-analysis microglia neurodegeneration statistics
📊 Synaptic pruning by microglia in early AD (neurodegeneration)
Created: 2026-04-01
View Notebook →