Notebook Artifact Registry

Computational analysis artifacts linked to analyses and knowledge graph entities

AllAPOE4AgingAllen InstituteAlzheimer'sCRISPRCircuit AnalysisCross-Age AnalysisEpigeneticsGene ExpressionImmune ResponseMicrogliaMouse ModelNeural DynamicsNeurodegenerationNeuroinflammationProtein PropagationSEA-ADSenescent CellsSenolyticsStructural BiologyTauTherapeutics[]agingalzheimersanalysisartifactastrocytesautobiomarkerscell-typescidraftepigeneticsforge-toolsgene-editinggene-expressionhypothesis-analysisknowledge-gaplipid-raftsmicroglianeurodegenerationneuroinflammationneuronsnotebooksea-adsenescenceshowcasesingle-cellstatisticsstubtautranscriptomicswalkthrough

🌟 Spotlight Notebooks

Mitochondrial Dysfunction as a Driver of Neurodegeneration

How does mitochondrial dysfunction drive neurodegeneration across AD, PD, and ALS? Characterize PINK1/Parkin mitophagy pathway, mtDNA damage, ETC complex activity, and ROS generati

[]
Created: 2026-04-12
View Notebook →

Tau Pathology Propagation in Tauopathies — Mechanistic Dissection

How does misfolded tau spread through the brain in tauopathies? Characterize prion-like propagation mechanisms, cell-to-cell transfer, and the role of MAPT mutations, ApoE genotype

[]
Created: 2026-04-12
View Notebook →

Neuroinflammation and microglial priming in early Alzheimer's Disease — Analysis Notebook

Mechanistic links between early microglial priming states, neuroinflammatory signaling, and AD progression. Forge-powered analysis with 14 hypotheses, 105 KG edges, and PubMed cita

showcase forge-tools neuroinflammation neurodegeneration
📊 Neuroinflammation and microglial priming in early Alzheimer's Disease
Created: 2026-04-11
View Notebook →

Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability — Analysis Notebook

Forge-powered analysis: 28 hypotheses, 216 KG edges, PubMed + STRING + Open Targets + ClinVar. 10 code cells, 5 plots.

showcase forge-tools transcriptomics neurodegeneration
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability
Created: 2026-04-11
View Notebook →

CRISPR-based therapeutic approaches for neurodegenerative diseases — Analysis Notebook

CRISPR-based therapeutic approaches for neurodegenerative diseases (Alzheimer, Parkinson, Huntington). Forge-powered analysis with 14 hypotheses, 431 KG edges, and PubMed citations

showcase forge-tools gene-editing neurodegeneration
📊 CRISPR-based therapeutic approaches for neurodegenerative diseases
Created: 2026-04-11
View Notebook →

All Notebooks (93) (filtered by: analysis)

Immune atlas neuroinflammation analysis in neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-03-gap-immune-atlas-neuroinflam-20260402. Comprehensive analysis of immune cell subtypes in neurodegeneration: microglia subtypes (DAM, homeostatic,

analysis auto ci
📊 Immune atlas neuroinflammation analysis in neurodegeneration (Neuroinflammation)
Created: 2026-04-12
View Notebook →

What is the actual quantitative contribution of FcRn-mediated transcytosis to BBB antibody transport in humans? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-12-gap-debate-20260410-112908-13c403ee. The debate revealed conflicting estimates ranging from <5% to 20% for FcRn's role in BBB transport, with spe

analysis auto ci
📊 What is the actual quantitative contribution of FcRn-mediated transcytosis to BBB antibody transport in humans? (neuropharmacology)
Created: 2026-04-12
View Notebook →

Systemic immune profiling and peripheral immune contributions to neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-frontier-immunomics-e6f97b29. How do peripheral immune system alterations influence CNS pathology and neurodegeneration in Alzheimer disease? Exa

analysis auto ci
📊 Systemic immune profiling and peripheral immune contributions to neurodegeneration (neurodegeneration)
Created: 2026-04-12
View Notebook →

Does reduced Prevotellaceae abundance cause PD pathology or result from it? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-11-gap-debate-20260410-111558-f9487fea. Does reduced Prevotellaceae abundance cause PD pathology or result from it?

analysis auto ci
📊 Does reduced Prevotellaceae abundance cause PD pathology or result from it? (neurodegeneration)
Created: 2026-04-11
View Notebook →

Lipid metabolism dysregulation and membrane integrity in Alzheimer disease — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-frontier-lipidomics-dcdbc360. How do alterations in brain lipid metabolism—including gangliosides, phospholipids, cholesterol transport, and sphi

analysis auto ci
📊 Lipid metabolism dysregulation and membrane integrity in Alzheimer disease (neurodegeneration)
Created: 2026-04-11
View Notebook →

Senescent cell clearance as neurodegeneration therapy — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-gap-senescent-clearance-neuro. Investigate the therapeutic potential of clearing senescent cells (senolytics) to slow or reverse neurodegeneratio

analysis auto ci
📊 Senescent cell clearance as neurodegeneration therapy (neurodegeneration)
Created: 2026-04-11
View Notebook →

Cell type vulnerability in Alzheimer's Disease (SEA-AD data) — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-03-gap-seaad-20260402025452. What cell types are most vulnerable in Alzheimers Disease based on SEA-AD transcriptomic data? Use Allen Brain Cell Atl

analysis auto ci
📊 Cell type vulnerability in Alzheimer's Disease (SEA-AD data) (neurodegeneration)
Created: 2026-04-11
View Notebook →

Epigenetic reprogramming in aging neurons — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-gap-epigenetic-reprog-b685190e. Investigate mechanisms of epigenetic reprogramming in aging neurons, including DNA methylation changes, histone m

analysis auto ci
📊 Epigenetic reprogramming in aging neurons (neurodegeneration)
Created: 2026-04-11
View Notebook →

SEA-AD Single-Cell Analysis: Cell-Type Vulnerability in Alzheimer's Disease — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-analysis_sea_ad_001. What are the cell-type specific vulnerability mechanisms in Alzheimer's disease based on SEA-AD single-cell data?

analysis auto ci
📊 SEA-AD Single-Cell Analysis: Cell-Type Vulnerability in Alzheimer's Disease (neurodegeneration)
Created: 2026-04-11
View Notebook →

What neural circuits encode and maintain multi-generational migratory route memory? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-08-gap-pubmed-20260406-062218-5c7f15f4. The paper describes memory-based migration routes maintained across generations but doesn't explain the neur

analysis auto ci
📊 What neural circuits encode and maintain multi-generational migratory route memory? (spatial memory)
Created: 2026-04-11
View Notebook →

Why do clinical manifestations overlap despite distinct underlying etiologies in immune-mediated myelopathies? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-08-gap-pubmed-20260406-062111-db808ee9. The abstract notes that clinical presentations overlap across different myelopathy etiologies, but the mecha

analysis auto ci
📊 Why do clinical manifestations overlap despite distinct underlying etiologies in immune-mediated myelopathies? (neuroinflammation)
Created: 2026-04-11
View Notebook →

Which specific metabolic pathways in APOE4+ microglia are most therapeutically tractable? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-08-gap-debate-20260406-062033-fecb8755. While APOE4 disrupts microglial metabolism broadly, the debate didn't identify which specific disrupted path

analysis auto ci
📊 Which specific metabolic pathways in APOE4+ microglia are most therapeutically tractable? (neurodegeneration)
Created: 2026-04-11
View Notebook →

Neuroinflammation and microglial priming in early AD — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-gap-neuroinflammation-microglial-20260404. How does microglial priming contribute to early Alzheimer's disease pathology? Focus on the mechanisms

analysis auto ci
📊 Neuroinflammation and microglial priming in early AD (neurodegeneration)
Created: 2026-04-11
View Notebook →

Tau propagation mechanisms and therapeutic interception points — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-gap-tau-prop-20260402003221. Investigate prion-like spreading of tau pathology through connected brain regions, focusing on trans-synaptic transf

analysis auto ci
📊 Tau propagation mechanisms and therapeutic interception points (neurodegeneration)
Created: 2026-04-11
View Notebook →

Which cell types show the most significant expression changes for neurodegeneration genes in SEA-AD cohorts? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-03-gap-debate-20260403-222543-20260402. The debate mentioned gene expression profiling but did not specify which neural cell populations (neurons, m

analysis auto ci
📊 Which cell types show the most significant expression changes for neurodegeneration genes in SEA-AD cohorts? (neurodegeneration)
Created: 2026-04-11
View Notebook →

Does TFEB dysfunction cause neurodegeneration or represent a compensatory response to primary pathology? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-03-gap-debate-20260403-222617-8eb5bdbc. The debate highlighted TFEB's role in mitochondrial-lysosomal coupling but couldn't resolve causation vs cor

analysis auto ci
📊 Does TFEB dysfunction cause neurodegeneration or represent a compensatory response to primary pathology? (neurodegeneration)
Created: 2026-04-11
View Notebook →

Circuit-level neural dynamics in neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-03-26abc5e5f9f2. Analyze circuit-level changes in neurodegeneration using Allen Institute Neural Dynamics data. Focus on: (1) hippocampal circuit di

analysis auto ci
📊 Circuit-level neural dynamics in neurodegeneration (neuroscience)
Created: 2026-04-11
View Notebook →

Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-03-gap-seaad-v4-20260402065846. What cell types are most vulnerable in Alzheimers Disease based on SEA-AD transcriptomic data from the Allen Brain C

analysis auto ci
📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-11
View Notebook →

Cell type vulnerability in Alzheimer's Disease (SEA-AD data - v2) — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-03-gap-seaad-v2-20260402032945. What cell types are most vulnerable in Alzheimer's Disease based on SEA-AD transcriptomic data from the Allen Brain

analysis auto ci
📊 Cell type vulnerability in Alzheimer's Disease (SEA-AD data - v2) (neurodegeneration)
Created: 2026-04-11
View Notebook →

SEA-AD Gene Expression Profiling — Allen Brain Cell Atlas — Analysis Notebook

CI-generated notebook stub for analysis analysis-SEAAD-20260402. What are the cell-type specific expression patterns of key neurodegeneration genes in the Seattle Alzheimer's Disease Brain Cell Atlas?

analysis auto ci
📊 SEA-AD Gene Expression Profiling — Allen Brain Cell Atlas (neurodegeneration)
Created: 2026-04-11
View Notebook →

Extracellular vesicle biomarkers for early AD detection — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-02-gap-ev-ad-biomarkers. Extracellular vesicles (EVs), including exosomes and microvesicles, carry molecular cargo (proteins, miRNAs, lipids) from t

analysis auto ci
📊 Extracellular vesicle biomarkers for early AD detection (neurodegeneration)
Created: 2026-04-11
View Notebook →

Metabolic reprogramming in neurodegenerative disease — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-02-gap-v2-5d0e3052. How does metabolic reprogramming (glucose metabolism shifts, brain insulin resistance, ketone body utilization) affect neuronal

analysis auto ci
📊 Metabolic reprogramming in neurodegenerative disease (neurodegeneration)
Created: 2026-04-11
View Notebook →

Epigenetic clocks and biological aging in neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-v2-bc5f270e. Epigenetic clocks and biological aging in neurodegeneration

analysis auto ci
📊 Epigenetic clocks and biological aging in neurodegeneration (neurodegeneration)
Created: 2026-04-11
View Notebook →

Sleep disruption as cause and consequence of neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-v2-18cf98ca. Sleep disruption as cause and consequence of neurodegeneration

analysis auto ci
📊 Sleep disruption as cause and consequence of neurodegeneration (neurodegeneration)
Created: 2026-04-11
View Notebook →

Mitochondrial transfer between astrocytes and neurons — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-v2-89432b95. Mitochondrial transfer between astrocytes and neurons

analysis auto ci
📊 Mitochondrial transfer between astrocytes and neurons (neurodegeneration)
Created: 2026-04-11
View Notebook →

RNA binding protein dysregulation across ALS FTD and AD — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-v2-68d9c9c1. RNA binding protein dysregulation across ALS FTD and AD

analysis auto ci
📊 RNA binding protein dysregulation across ALS FTD and AD (neurodegeneration)
Created: 2026-04-11
View Notebook →

Perivascular spaces and glymphatic clearance failure in AD — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-v2-ee5a5023. Perivascular spaces and glymphatic clearance failure in AD

analysis auto ci
📊 Perivascular spaces and glymphatic clearance failure in AD (neurodegeneration)
Created: 2026-04-11
View Notebook →

Synaptic pruning by microglia in early AD — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-v2-691b42f1. Synaptic pruning by microglia in early AD

analysis auto ci
📊 Synaptic pruning by microglia in early AD (neurodegeneration)
Created: 2026-04-11
View Notebook →

Neuroinflammation resolution mechanisms and pro-resolving mediators — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-014. SPMs (resolvins, protectins, maresins) from omega-3s may promote inflammation resolution. Are resolution failures druggable?

analysis auto ci
📊 Neuroinflammation resolution mechanisms and pro-resolving mediators (neurodegeneration)
Created: 2026-04-11
View Notebook →

Digital biomarkers and AI-driven early detection of neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-012. Can speech, gait, retinal imaging, sleep, and smartphone data detect neurodegeneration 5-10 years before diagnosis?

analysis auto ci
📊 Digital biomarkers and AI-driven early detection of neurodegeneration (neurodegeneration)
Created: 2026-04-11
View Notebook →

Senolytic therapy for age-related neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-013. Senolytics targeting p16/p21+ senescent astrocytes and microglia may reduce SASP-driven neuroinflammation.

analysis auto ci
📊 Senolytic therapy for age-related neurodegeneration (neurodegeneration)
Created: 2026-04-11
View Notebook →

Autophagy-lysosome pathway convergence across neurodegenerative diseases — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-011. Multiple NDDs converge on autophagy-lysosome dysfunction. Are there universal therapeutic targets?

analysis auto ci
📊 Autophagy-lysosome pathway convergence across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-11
View Notebook →

Microglia-astrocyte crosstalk amplification loops in neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-009. Microglia activate astrocytes via IL-1alpha/TNF/C1q, and reactive astrocytes feed back to microglia via complement/chemokines.

analysis auto ci
📊 Microglia-astrocyte crosstalk amplification loops in neurodegeneration (neurodegeneration)
Created: 2026-04-11
View Notebook →

APOE4 structural biology and therapeutic targeting strategies — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-010. APOE4 differs from APOE3 by C112R causing domain interaction that alters lipid binding and amyloid clearance.

analysis auto ci
📊 APOE4 structural biology and therapeutic targeting strategies (neurodegeneration)
Created: 2026-04-11
View Notebook →

TDP-43 phase separation therapeutics for ALS-FTD — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-006. TDP-43 undergoes liquid-liquid phase separation that becomes pathological. Small molecules targeting phase separation properties could b

analysis auto ci
📊 TDP-43 phase separation therapeutics for ALS-FTD (neurodegeneration)
Created: 2026-04-11
View Notebook →

Astrocyte reactivity subtypes in neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-007. Astrocytes adopt A1 (neurotoxic) and A2 (neuroprotective) phenotypes, but recent single-cell data reveals far greater heterogeneity. Map

analysis auto ci
📊 Astrocyte reactivity subtypes in neurodegeneration (neurodegeneration)
Created: 2026-04-11
View Notebook →

4R-tau strain-specific spreading patterns in PSP vs CBD — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-005. PSP and CBD both involve 4R-tau but produce distinct neuropathological patterns (tufted astrocytes vs astrocytic plaques). Whether tau s

analysis auto ci
📊 4R-tau strain-specific spreading patterns in PSP vs CBD (neurodegeneration)
Created: 2026-04-11
View Notebook →

Selective vulnerability of entorhinal cortex layer II neurons in AD — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-004. Why do entorhinal cortex layer II stellate neurons die first in AD? Their unique electrophysiological properties, grid cell function, an

analysis auto ci
📊 Selective vulnerability of entorhinal cortex layer II neurons in AD (neurodegeneration)
Created: 2026-04-11
View Notebook →

Blood-brain barrier transport mechanisms for antibody therapeutics — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-008. Anti-amyloid antibodies (lecanemab, donanemab) have ~0.1% brain penetrance. Engineering improved BBB transcytosis via transferrin recept

analysis auto ci
📊 Blood-brain barrier transport mechanisms for antibody therapeutics (neurodegeneration)
Created: 2026-04-11
View Notebook →

Lipid raft composition changes in synaptic neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-01-gap-lipid-rafts-2026-04-01. Investigate how lipid raft composition (cholesterol metabolism, sphingolipids) changes in synaptic membranes during n

analysis auto ci
📊 Lipid raft composition changes in synaptic neurodegeneration (neurodegeneration)
Created: 2026-04-11
View Notebook →

GBA-Synuclein Loop: Therapeutic Strategies for Parkinson's Disease — Analysis Notebook

CI-generated notebook stub for analysis gba-pd. GBA-Synuclein Loop: Therapeutic Strategies for Parkinson's Disease?

analysis auto ci
📊 GBA-Synuclein Loop: Therapeutic Strategies for Parkinson's Disease (neurodegeneration)
Created: 2026-04-11
View Notebook →

Gut-Brain Axis Therapeutics for Alzheimer's Disease — Analysis Notebook

CI-generated notebook stub for analysis gut-brain-ad. Gut-Brain Axis Therapeutics for Alzheimer's Disease?

analysis auto ci
📊 Gut-Brain Axis Therapeutics for Alzheimer's Disease (neurodegeneration)
Created: 2026-04-11
View Notebook →

What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-20260401-225149. What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain

analysis auto ci
📊 What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? (neurodegeneration)
Created: 2026-04-11
View Notebook →

Mitochondrial transfer between neurons and glia — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-20260401231108. Mitochondrial transfer between neurons and glia?

analysis auto ci
📊 Mitochondrial transfer between neurons and glia (neurodegeneration)
Created: 2026-04-11
View Notebook →

Protein aggregation cross-seeding across neurodegenerative diseases — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-9137255b. Protein aggregation cross-seeding across neurodegenerative diseases?

analysis auto ci
📊 Protein aggregation cross-seeding across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-11
View Notebook →

Mechanistic role of APOE in neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-auto-fd6b1635d9. Mechanistic role of APOE in neurodegeneration?

analysis auto ci
📊 Mechanistic role of APOE in neurodegeneration (neurodegeneration)
Created: 2026-04-11
View Notebook →

TREM2 Therapeutic Strategy Post-INVOKE-2 — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-001. What are the most promising therapeutic strategies for targeting TREM2 in Alzheimer's disease, given the INVOKE-2 failure?

analysis auto ci
📊 TREM2 Therapeutic Strategy Post-INVOKE-2 (neurodegeneration)
Created: 2026-04-11
View Notebook →

GBA-Synuclein Loop Therapeutics for PD — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-002. How to break the GBA-alpha-synuclein bidirectional loop for Parkinson's Disease therapy?

analysis auto ci
📊 GBA-Synuclein Loop Therapeutics for PD (neurodegeneration)
Created: 2026-04-11
View Notebook →

Gut-Brain Axis Therapeutics for AD — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-003. Can gut-brain axis modulation prevent or slow Alzheimer's disease pathology?

analysis auto ci
📊 Gut-Brain Axis Therapeutics for AD (neurodegeneration)
Created: 2026-04-11
View Notebook →

Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-03-gap-aging-mouse-brain-v2-20260402. What gene expression changes in the aging mouse brain predict neurodegenerative vulnerability? Use Allen Aging

analysis auto ci
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-06
View Notebook →

Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-03-gap-aging-mouse-brain-20260402. What gene expression changes in the aging mouse brain predict neurodegenerative vulnerability? Use Allen Aging Mo

analysis auto ci
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-06
View Notebook →

TREM2 Therapeutic Strategy Post-INVOKE-2 — Analysis Notebook

Computational analysis notebook for 'TREM2 Therapeutic Strategy Post-INVOKE-2'. Domain: neurodegeneration. Research question: Analysis question not specified

analysis artifact notebook
📊 TREM2 Therapeutic Strategy Post-INVOKE-2 (neurodegeneration)
Created: 2026-04-04
View Notebook →

ACSL4-Driven Ferroptotic Priming in Disease-Associated Microglia

Hypothesis ID: h-seaad-v4-26ba859b | Composite Score: 0.82/1.00

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
Created: 2026-04-04
View Notebook →

Cell-Type Specific TREM2 Upregulation in DAM Microglia

Hypothesis ID: h-seaad-51323624 | Composite Score: 0.73/1.00

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
Created: 2026-04-04
View Notebook →

Proteostasis Enhancement via APOE Chaperone Targeting

Hypothesis ID: h-5d943bfc | Composite Score: 0.74/1.00

gene-expression hypothesis-analysis neurodegeneration statistics
Created: 2026-04-04

APOE-Dependent Autophagy Restoration

Hypothesis ID: h-51e7234f | Composite Score: 0.80/1.00

gene-expression hypothesis-analysis neurodegeneration statistics
Created: 2026-04-04

Targeted Butyrate Supplementation for Microglial Phenotype Modulation

Hypothesis ID: h-3d545f4e | Composite Score: 0.79/1.00

gene-expression hypothesis-analysis microglia neurodegeneration statistics
Created: 2026-04-04

Gamma entrainment therapy to restore hippocampal-cortical synchrony

Hypothesis ID: h-bdbd2120

gene-expression hypothesis-analysis neurodegeneration statistics
Created: 2026-04-04

SEA-AD Single-Cell Analysis: Cell-Type Vulnerability in Alzheimer's Disease — Analysis Notebook

CI-generated notebook stub for analysis analysis_sea_ad_001. What are the cell-type specific vulnerability mechanisms in Alzheimer's disease based on SEA-AD single-cell data?

analysis auto ci
📊 SEA-AD Single-Cell Analysis: Cell-Type Vulnerability in Alzheimer's Disease (neurodegeneration)
Created: 2026-04-04
View Notebook →

Astrocyte Reactivity Subtypes in Neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis astrocyte-subtypes. Analysis question not specified

analysis auto ci
📊 Astrocyte Reactivity Subtypes in Neurodegeneration (neurodegeneration)
Created: 2026-04-04
View Notebook →

Neuroinflammation and microglial priming in early Alzheimer's Disease - Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-gap-neuro-microglia-early-ad-20260404. Investigate the role of neuroinflammation and microglial priming in the earliest stages of Alzheimer's Dis

analysis auto ci
📊 Neuroinflammation and microglial priming in early Alzheimer's Disease (neurodegeneration)
Created: 2026-04-04
View Notebook →

Aging Mouse Brain Atlas: Cross-Age Gene Expression Analysis

Differential expression analysis across hippocampus, cortex, and cerebellum in young, middle-aged, and old mice. Identifies aging-neurodegeneration overlap with 5 testable hypotheses.

Aging Mouse Model Gene Expression Neurodegeneration Cross-Age Analysis
APOE TREM2 GFAP SYP TFAM
Created: 2026-04-02
View Notebook →

Circuit-level neural dynamics in neurodegeneration

Analyze circuit-level changes in neurodegeneration using Allen Institute Neural Dynamics data. Focus on: (1) hippocampal circuit disruption, (2) cortical dynamics alterations, (3) sensory processing c

gene-expression hypothesis-analysis neurodegeneration statistics
📊 Circuit-level neural dynamics in neurodegeneration (neuroscience)
Created: 2026-04-02
View Notebook →

Gene Expression in Aging Mouse Brain Predicting Neurodegeneration (v1)

What gene expression changes in the aging mouse brain predict neurodegenerative vulnerability? Using Allen Brain Atlas aging datasets, identify conserved transcriptomic signatures across 3, 12, 18, an

aging gene-expression hypothesis-analysis neurodegeneration statistics
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-02
View Notebook →

Cellular Senescence Signatures in Aging Mouse Brain (v5)

Which cellular senescence markers in aging mouse brain best predict downstream neurodegeneration risk? Focus on p21/p16 axis, SASP factors, and their interaction with neuroinflammatory cascades.

aging gene-expression hypothesis-analysis microglia neurodegeneration
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-02
View Notebook →

CRISPR-Based Therapeutic Approaches for Neurodegenerative Diseases

Analysis ID: SDA-2026-04-02-gap-crispr-neurodegeneration-20260402 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 5 Knowledge Graph Edges: 15

CRISPR SEA-AD epigenetics gene-expression hypothesis-analysis
📊 CRISPR-based therapeutic approaches for neurodegenerative diseases (neurodegeneration)
Created: 2026-04-02
View Notebook →

Epigenetic Reprogramming in Aging Neurons — Mechanistic Analysis

Investigate mechanisms of epigenetic reprogramming in aging neurons. How do changes in DNA methylation, histone modification, and chromatin remodeling contribute to neurodegeneration risk?

SEA-AD epigenetics gene-expression hypothesis-analysis microglia
📊 Epigenetic reprogramming in aging neurons (neurodegeneration)
Created: 2026-04-02
View Notebook →

Extracellular Vesicle Biomarkers for Early Alzheimer's Disease Detection

Which extracellular vesicle (EV) cargo proteins best discriminate early AD from controls? Characterize EV proteome from plasma, CSF, and brain tissue across disease stages using multi-cohort data.

SEA-AD biomarkers gene-expression hypothesis-analysis microglia
📊 Extracellular vesicle biomarkers for early AD detection (neurodegeneration)
Created: 2026-04-02
View Notebook →

SEA-AD v4: Inhibitory Neuron Subtypes and Circuit Vulnerability in AD

Which inhibitory neuron subtypes show earliest transcriptomic divergence in AD? Characterize Sst, Pvalb, and Vip+ interneuron vulnerability and link to circuit dysfunction biomarkers.

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-02
View Notebook →

Senescent Cell Clearance as Neurodegeneration Therapy

Analysis ID: SDA-2026-04-02-gap-senescent-clearance-neuro Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 5 Knowledge Graph Edges: 15

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Senescent cell clearance as neurodegeneration therapy (neurodegeneration)
Created: 2026-04-02
View Notebook →

Tau propagation mechanisms and therapeutic interception points

Analysis ID: SDA-2026-04-02-gap-tau-prop-20260402003221 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 77

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Tau propagation mechanisms and therapeutic interception points (neurodegeneration)
Created: 2026-04-02
View Notebook →

Metabolic reprogramming in neurodegenerative disease

Analysis ID: SDA-2026-04-02-gap-v2-5d0e3052 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 3 Knowledge Graph Edges: 31

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Metabolic reprogramming in neurodegenerative disease (neurodegeneration)
Created: 2026-04-02
View Notebook →

SEA-AD Gene Expression Profiling — Allen Brain Cell Atlas

Analysis ID: analysis-SEAAD-20260402 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 5 Knowledge Graph Edges: 63

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 SEA-AD Gene Expression Profiling — Allen Brain Cell Atlas (neurodegeneration)
Created: 2026-04-02
View Notebook →

Circuit-Level Neural Dynamics in Neurodegeneration

Analyze circuit-level changes in neurodegeneration using Allen Institute Neural Dynamics data. Focus on how ion channel dysfunction and synaptic failure drive progressive circuit collapse in AD, PD, a

Allen Institute Neural Dynamics Circuit Analysis Neurodegeneration
📊 Circuit-level neural dynamics in neurodegeneration (neuroscience)
Created: 2026-04-02
View Notebook →

TREM2 agonism vs antagonism in DAM microglia

Analysis ID: SDA-2026-04-01-gap-001 Date: 2026-04-01 Domain: neurodegeneration Key Hypotheses: - TREM2-Dependent Microglial Senescence Transition (score: 0.705) - Cell-Type Specific TREM

SEA-AD gene-expression hypothesis-analysis knowledge-gap microglia
📊 TREM2 agonism vs antagonism in DAM microglia (neurodegeneration)
Created: 2026-04-01
View Notebook →

Selective vulnerability of entorhinal cortex layer II neurons in AD

Analysis ID: SDA-2026-04-01-gap-004 Date: 2026-04-01 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 83

SEA-AD gene-expression hypothesis-analysis knowledge-gap microglia
📊 Selective vulnerability of entorhinal cortex layer II neurons in AD (neurodegeneration)
Created: 2026-04-01
View Notebook →

4R-tau strain-specific spreading patterns in PSP vs CBD

Analysis ID: SDA-2026-04-01-gap-005 Date: 2026-04-01 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 112

SEA-AD gene-expression hypothesis-analysis knowledge-gap microglia
📊 4R-tau strain-specific spreading patterns in PSP vs CBD (neurodegeneration)
Created: 2026-04-01
View Notebook →

TDP-43 phase separation therapeutics for ALS-FTD

What are the mechanisms underlying tdp-43 phase separation therapeutics for als-ftd?

gene-expression hypothesis-analysis neurodegeneration statistics
📊 TDP-43 phase separation therapeutics for ALS-FTD (neurodegeneration)
Created: 2026-04-01
View Notebook →

Astrocyte reactivity subtypes in neurodegeneration

Analysis ID: SDA-2026-04-01-gap-007 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 20

SEA-AD epigenetics gene-expression hypothesis-analysis microglia
📊 Astrocyte reactivity subtypes in neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Blood-brain barrier transport mechanisms for antibody therapeutics

Analysis ID: SDA-2026-04-01-gap-008 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 20

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Blood-brain barrier transport mechanisms for antibody therapeutics (neurodegeneration)
Created: 2026-04-01
View Notebook →

Microglia-astrocyte crosstalk amplification loops in neurodegeneration

Analysis ID: SDA-2026-04-01-gap-009 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 20

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Microglia-astrocyte crosstalk amplification loops in neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

APOE4 structural biology and therapeutic targeting strategies

Analysis ID: SDA-2026-04-01-gap-010 Date: 2026-04-01 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 81

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 APOE4 structural biology and therapeutic targeting strategies (neurodegeneration)
Created: 2026-04-01
View Notebook →

Autophagy-lysosome pathway convergence across neurodegenerative diseases

What are the mechanisms underlying autophagy-lysosome pathway convergence across neurodegenerative diseases?

gene-expression hypothesis-analysis neurodegeneration statistics
📊 Autophagy-lysosome pathway convergence across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-01
View Notebook →

Digital biomarkers and AI-driven early detection of neurodegeneration

Analysis ID: SDA-2026-04-01-gap-012 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 20

SEA-AD biomarkers gene-expression hypothesis-analysis microglia
📊 Digital biomarkers and AI-driven early detection of neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Senolytic therapy for age-related neurodegeneration

Analysis ID: SDA-2026-04-01-gap-013 Date: 2026-04-01 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 282

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Senolytic therapy for age-related neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis?

What are the mechanisms underlying what are the mechanisms by which gut microbiome dysbiosis influences parkinson's disease pathogenesis through the gut-brain axis??

gene-expression hypothesis-analysis neurodegeneration statistics
📊 What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? (neurodegeneration)
Created: 2026-04-01
View Notebook →

Mitochondrial transfer between neurons and glia

Analysis ID: SDA-2026-04-01-gap-20260401231108 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 0

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Mitochondrial transfer between neurons and glia (neurodegeneration)
Created: 2026-04-01
View Notebook →

Mechanistic role of APOE in neurodegeneration

What are the mechanisms underlying mechanistic role of apoe in neurodegeneration?

gene-expression hypothesis-analysis lipid-rafts neurodegeneration statistics
📊 Mechanistic role of APOE in neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Lipid raft composition changes in synaptic neurodegeneration

Investigate how lipid raft composition (cholesterol metabolism, sphingolipids) changes in synaptic membranes during neurodegeneration and their mechanistic role in amyloid-beta processing and synapse

gene-expression hypothesis-analysis lipid-rafts neurodegeneration statistics
📊 Lipid raft composition changes in synaptic neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Sleep disruption as cause and consequence of neurodegeneration

What are the mechanisms underlying sleep disruption as cause and consequence of neurodegeneration?

gene-expression hypothesis-analysis microglia neurodegeneration statistics
📊 Sleep disruption as cause and consequence of neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

RNA binding protein dysregulation across ALS FTD and AD

What are the mechanisms underlying rna binding protein dysregulation across als ftd and ad?

gene-expression hypothesis-analysis neurodegeneration statistics
📊 RNA binding protein dysregulation across ALS FTD and AD (neurodegeneration)
Created: 2026-04-01
View Notebook →

Synaptic pruning by microglia in early AD

What are the mechanisms underlying synaptic pruning by microglia in early ad?

gene-expression hypothesis-analysis microglia neurodegeneration statistics
📊 Synaptic pruning by microglia in early AD (neurodegeneration)
Created: 2026-04-01
View Notebook →

Perivascular spaces and glymphatic clearance failure in AD

What are the mechanisms underlying perivascular spaces and glymphatic clearance failure in ad?

gene-expression hypothesis-analysis neurodegeneration statistics
📊 Perivascular spaces and glymphatic clearance failure in AD (neurodegeneration)
Created: 2026-04-01
View Notebook →