Notebook Artifact Registry

Computational analysis artifacts linked to analyses and knowledge graph entities

AllAPOE4AgingAllen InstituteAlzheimer'sCRISPRCircuit AnalysisCross-Age AnalysisEpigeneticsGene ExpressionImmune ResponseMicrogliaMouse ModelNeural DynamicsNeurodegenerationNeuroinflammationProtein PropagationSEA-ADSenescent CellsSenolyticsStructural BiologyTauTherapeutics[]agingalzheimersanalysisartifactastrocytesautobiomarkerscell-typescidraftepigeneticsforge-toolsgene-editinggene-expressionhypothesis-analysisknowledge-gaplipid-raftsmicroglianeurodegenerationneuroinflammationneuronsnotebooksea-adsenescenceshowcasesingle-cellstatisticsstubtautranscriptomicswalkthrough

🌟 Spotlight Notebooks

Mitochondrial Dysfunction as a Driver of Neurodegeneration

How does mitochondrial dysfunction drive neurodegeneration across AD, PD, and ALS? Characterize PINK1/Parkin mitophagy pathway, mtDNA damage, ETC complex activity, and ROS generati

[]
Created: 2026-04-12
View Notebook →

Tau Pathology Propagation in Tauopathies — Mechanistic Dissection

How does misfolded tau spread through the brain in tauopathies? Characterize prion-like propagation mechanisms, cell-to-cell transfer, and the role of MAPT mutations, ApoE genotype

[]
Created: 2026-04-12
View Notebook →

Neuroinflammation and microglial priming in early Alzheimer's Disease — Analysis Notebook

Mechanistic links between early microglial priming states, neuroinflammatory signaling, and AD progression. Forge-powered analysis with 14 hypotheses, 105 KG edges, and PubMed cita

showcase forge-tools neuroinflammation neurodegeneration
📊 Neuroinflammation and microglial priming in early Alzheimer's Disease
Created: 2026-04-11
View Notebook →

Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability — Analysis Notebook

Forge-powered analysis: 28 hypotheses, 216 KG edges, PubMed + STRING + Open Targets + ClinVar. 10 code cells, 5 plots.

showcase forge-tools transcriptomics neurodegeneration
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability
Created: 2026-04-11
View Notebook →

CRISPR-based therapeutic approaches for neurodegenerative diseases — Analysis Notebook

CRISPR-based therapeutic approaches for neurodegenerative diseases (Alzheimer, Parkinson, Huntington). Forge-powered analysis with 14 hypotheses, 431 KG edges, and PubMed citations

showcase forge-tools gene-editing neurodegeneration
📊 CRISPR-based therapeutic approaches for neurodegenerative diseases
Created: 2026-04-11
View Notebook →

All Notebooks (70) (filtered by: gene-expression)

ACSL4-Driven Ferroptotic Priming in Disease-Associated Microglia

Hypothesis ID: h-seaad-v4-26ba859b | Composite Score: 0.82/1.00

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
Created: 2026-04-04
View Notebook →

Cell-Type Specific TREM2 Upregulation in DAM Microglia

Hypothesis ID: h-seaad-51323624 | Composite Score: 0.73/1.00

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
Created: 2026-04-04
View Notebook →

Proteostasis Enhancement via APOE Chaperone Targeting

Hypothesis ID: h-5d943bfc | Composite Score: 0.74/1.00

gene-expression hypothesis-analysis neurodegeneration statistics
Created: 2026-04-04

APOE-Dependent Autophagy Restoration

Hypothesis ID: h-51e7234f | Composite Score: 0.80/1.00

gene-expression hypothesis-analysis neurodegeneration statistics
Created: 2026-04-04

Targeted Butyrate Supplementation for Microglial Phenotype Modulation

Hypothesis ID: h-3d545f4e | Composite Score: 0.79/1.00

gene-expression hypothesis-analysis microglia neurodegeneration statistics
Created: 2026-04-04

Gamma entrainment therapy to restore hippocampal-cortical synchrony

Hypothesis ID: h-bdbd2120

gene-expression hypothesis-analysis neurodegeneration statistics
Created: 2026-04-04

Aging Mouse Brain Atlas: Cross-Age Gene Expression Analysis

Identify age-related gene expression changes across hippocampus, cortex, and cerebellum to understand aging-neurodegeneration overlap

aging gene-expression neurodegeneration statistics
Created: 2026-04-04
View Notebook →

SEA-AD Gene Expression Analysis: Microglia vs Neurons in Alzheimer's Disease

Notebook ID: SEA-AD-gene-expression-analysis

SEA-AD gene-expression microglia neurodegeneration statistics
Created: 2026-04-04
View Notebook →

Immune Atlas: Neuroinflammation in Neurodegeneration

Analysis ID: SDA-2026-04-02-gap-immune-atlas-neuroinflam-20260402 Date: 2026-04-02 Domain: Neuroinflammation

gene-expression microglia neurodegeneration neuroinflammation statistics
📊 Immune atlas neuroinflammation analysis in neurodegeneration (Neuroinflammation)
Created: 2026-04-02
View Notebook →

Cell-Type Vulnerability in Alzheimer's Disease — SEA-AD Transcriptomics (v3)

What cell types are most vulnerable in Alzheimer's Disease based on SEA-AD transcriptomic data? Identify differential gene expression, vulnerability scores, and regulatory networks in excitatory neuro

SEA-AD gene-expression microglia neurodegeneration statistics
📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-02
View Notebook →

Cell-Type Vulnerability in Alzheimer's Disease — SEA-AD Transcriptomics (v4)

Extended SEA-AD analysis: identify cell-type-specific gene regulatory networks that predict vulnerability. Focus on super-enhancer-linked genes, TF binding, and cross-cell-type communication in AD-aff

SEA-AD gene-expression microglia neurodegeneration statistics
📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-02
View Notebook →

Tau propagation mechanisms and therapeutic interception points

Analysis ID: SDA-2026-04-02-gap-tau-prop-20260402003221

gene-expression microglia neurodegeneration statistics tau
📊 Tau propagation mechanisms and therapeutic interception points (neurodegeneration)
Created: 2026-04-02
View Notebook →

Circuit-level neural dynamics in neurodegeneration

Analyze circuit-level changes in neurodegeneration using Allen Institute Neural Dynamics data. Focus on: (1) hippocampal circuit disruption, (2) cortical dynamics alterations, (3) sensory processing c

gene-expression hypothesis-analysis neurodegeneration statistics
📊 Circuit-level neural dynamics in neurodegeneration (neuroscience)
Created: 2026-04-02
View Notebook →

Gene Expression in Aging Mouse Brain Predicting Neurodegeneration (v1)

What gene expression changes in the aging mouse brain predict neurodegenerative vulnerability? Using Allen Brain Atlas aging datasets, identify conserved transcriptomic signatures across 3, 12, 18, an

aging gene-expression hypothesis-analysis neurodegeneration statistics
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-02
View Notebook →

Cellular Senescence Signatures in Aging Mouse Brain (v5)

Which cellular senescence markers in aging mouse brain best predict downstream neurodegeneration risk? Focus on p21/p16 axis, SASP factors, and their interaction with neuroinflammatory cascades.

aging gene-expression hypothesis-analysis microglia neurodegeneration
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-02
View Notebook →

CRISPR-Based Therapeutic Approaches for Neurodegenerative Diseases

Analysis ID: SDA-2026-04-02-gap-crispr-neurodegeneration-20260402 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 5 Knowledge Graph Edges: 15

CRISPR SEA-AD epigenetics gene-expression hypothesis-analysis
📊 CRISPR-based therapeutic approaches for neurodegenerative diseases (neurodegeneration)
Created: 2026-04-02
View Notebook →

Epigenetic Reprogramming in Aging Neurons — Mechanistic Analysis

Investigate mechanisms of epigenetic reprogramming in aging neurons. How do changes in DNA methylation, histone modification, and chromatin remodeling contribute to neurodegeneration risk?

SEA-AD epigenetics gene-expression hypothesis-analysis microglia
📊 Epigenetic reprogramming in aging neurons (neurodegeneration)
Created: 2026-04-02
View Notebook →

Extracellular Vesicle Biomarkers for Early Alzheimer's Disease Detection

Which extracellular vesicle (EV) cargo proteins best discriminate early AD from controls? Characterize EV proteome from plasma, CSF, and brain tissue across disease stages using multi-cohort data.

SEA-AD biomarkers gene-expression hypothesis-analysis microglia
📊 Extracellular vesicle biomarkers for early AD detection (neurodegeneration)
Created: 2026-04-02
View Notebook →

SEA-AD v4: Inhibitory Neuron Subtypes and Circuit Vulnerability in AD

Which inhibitory neuron subtypes show earliest transcriptomic divergence in AD? Characterize Sst, Pvalb, and Vip+ interneuron vulnerability and link to circuit dysfunction biomarkers.

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-02
View Notebook →

Senescent Cell Clearance as Neurodegeneration Therapy

Analysis ID: SDA-2026-04-02-gap-senescent-clearance-neuro Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 5 Knowledge Graph Edges: 15

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Senescent cell clearance as neurodegeneration therapy (neurodegeneration)
Created: 2026-04-02
View Notebook →

Tau propagation mechanisms and therapeutic interception points

Analysis ID: SDA-2026-04-02-gap-tau-prop-20260402003221 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 77

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Tau propagation mechanisms and therapeutic interception points (neurodegeneration)
Created: 2026-04-02
View Notebook →

Metabolic reprogramming in neurodegenerative disease

Analysis ID: SDA-2026-04-02-gap-v2-5d0e3052 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 3 Knowledge Graph Edges: 31

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Metabolic reprogramming in neurodegenerative disease (neurodegeneration)
Created: 2026-04-02
View Notebook →

SEA-AD Gene Expression Profiling — Allen Brain Cell Atlas

Analysis ID: analysis-SEAAD-20260402 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 5 Knowledge Graph Edges: 63

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 SEA-AD Gene Expression Profiling — Allen Brain Cell Atlas (neurodegeneration)
Created: 2026-04-02
View Notebook →

TDP-43 phase separation therapeutics for ALS-FTD — Gene Expression & Pathway Analysis

Analysis ID: SDA-2026-04-01-gap-006 Date: 2026-04-03 Focus: phase separation dynamics and RNA-protein granule pathology

gene-expression neurodegeneration statistics
📊 TDP-43 phase separation therapeutics for ALS-FTD (neurodegeneration)
Created: 2026-04-01
View Notebook →

TDP-43 phase separation therapeutics for ALS-FTD — Statistical Deep Dive

Analysis ID: SDA-2026-04-01-gap-006 Date: 2026-04-03

gene-expression neurodegeneration statistics
📊 TDP-43 phase separation therapeutics for ALS-FTD (neurodegeneration)
Created: 2026-04-01
View Notebook →

Astrocyte reactivity subtypes in neurodegeneration

What are the mechanisms underlying astrocyte reactivity subtypes in neurodegeneration?

epigenetics gene-expression neurodegeneration statistics
📊 Astrocyte reactivity subtypes in neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Blood-brain barrier transport mechanisms for antibody therapeutics

What are the mechanisms underlying blood-brain barrier transport mechanisms for antibody therapeutics?

gene-expression neurodegeneration statistics
📊 Blood-brain barrier transport mechanisms for antibody therapeutics (neurodegeneration)
Created: 2026-04-01
View Notebook →

Microglia-astrocyte crosstalk amplification loops in neurodegeneration — Gene Expression & Pathway Analysis

Analysis ID: SDA-2026-04-01-gap-009 Date: 2026-04-03 Focus: glial crosstalk amplification loops in neuroinflammation

gene-expression microglia neurodegeneration neuroinflammation statistics
📊 Microglia-astrocyte crosstalk amplification loops in neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Microglia-astrocyte crosstalk amplification loops in neurodegeneration — Statistical Deep Dive

Analysis ID: SDA-2026-04-01-gap-009 Date: 2026-04-03

gene-expression microglia neurodegeneration neuroinflammation statistics
📊 Microglia-astrocyte crosstalk amplification loops in neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Microglia-astrocyte crosstalk amplification loops in neurodegeneration

What are the mechanisms underlying microglia-astrocyte crosstalk amplification loops in neurodegeneration?

gene-expression microglia neurodegeneration statistics
📊 Microglia-astrocyte crosstalk amplification loops in neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

APOE4 Structural Biology and Therapeutic Targeting Strategies

What are the structural mechanisms underlying APOE4 pathogenicity and how can they be exploited for therapeutic intervention?

gene-expression neurodegeneration statistics
📊 APOE4 structural biology and therapeutic targeting strategies (neurodegeneration)
Created: 2026-04-01
View Notebook →

Autophagy-lysosome pathway convergence across neurodegenerative diseases — Gene Expression & Pathway Analysis

Analysis ID: SDA-2026-04-01-gap-011 Date: 2026-04-03 Focus: autophagy-lysosome convergence across neurodegenerative diseases

gene-expression neurodegeneration statistics
📊 Autophagy-lysosome pathway convergence across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-01
View Notebook →

Autophagy-lysosome pathway convergence across neurodegenerative diseases — Statistical Deep Dive

Analysis ID: SDA-2026-04-01-gap-011 Date: 2026-04-03

gene-expression neurodegeneration statistics
📊 Autophagy-lysosome pathway convergence across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-01
View Notebook →

Autophagy-lysosome pathway convergence across neurodegenerative diseases

What are the mechanisms underlying autophagy-lysosome pathway convergence across neurodegenerative diseases?

gene-expression neurodegeneration statistics
📊 Autophagy-lysosome pathway convergence across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-01
View Notebook →

Digital biomarkers and AI-driven early detection of neurodegeneration

What are the mechanisms underlying digital biomarkers and ai-driven early detection of neurodegeneration?

biomarkers gene-expression neurodegeneration statistics
📊 Digital biomarkers and AI-driven early detection of neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Senolytic therapy for age-related neurodegeneration

What are the mechanisms underlying senolytic therapy for age-related neurodegeneration?

gene-expression neurodegeneration senescence statistics
📊 Senolytic therapy for age-related neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Neuroinflammation Resolution Mechanisms and Pro-Resolving Mediators

How do specialized pro-resolving mediators (SPMs) resolve neuroinflammation, and can their pathways be therapeutically enhanced?

gene-expression microglia neurodegeneration neuroinflammation senescence
📊 Neuroinflammation resolution mechanisms and pro-resolving mediators (neurodegeneration)
Created: 2026-04-01
View Notebook →

Gut Microbiome Dysbiosis and Parkinson's Disease via the Gut-Brain Axis

Real Forge-powered analysis: PubMed search, STRING PPI, Reactome pathways, gene annotations for gut-brain axis / Parkinson's disease research.

showcase forge-tools gene-expression neurodegeneration
📊 What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? (neurodegeneration)
Created: 2026-04-01
View Notebook →

What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis?

What are the mechanisms underlying what are the mechanisms by which gut microbiome dysbiosis influences parkinson's disease pathogenesis through the gut-brain axis??

gene-expression neurodegeneration statistics
📊 What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? (neurodegeneration)
Created: 2026-04-01
View Notebook →

Mitochondrial transfer between neurons and glia

Analysis ID: SDA-2026-04-01-gap-20260401231108

gene-expression microglia neurodegeneration statistics
📊 Mitochondrial transfer between neurons and glia (neurodegeneration)
Created: 2026-04-01
View Notebook →

Protein aggregation cross-seeding across neurodegenerative diseases

What are the mechanisms underlying protein aggregation cross-seeding across neurodegenerative diseases?

gene-expression neurodegeneration statistics
📊 Protein aggregation cross-seeding across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-01
View Notebook →

Sleep disruption as cause and consequence of neurodegeneration — Gene Expression & Pathway Analysis

Analysis ID: SDA-2026-04-01-gap-v2-18cf98ca Date: 2026-04-03 Focus: bidirectional relationship between sleep disruption and neurodegeneration

gene-expression neurodegeneration statistics
📊 Sleep disruption as cause and consequence of neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Sleep disruption as cause and consequence of neurodegeneration — Statistical Deep Dive

Analysis ID: SDA-2026-04-01-gap-v2-18cf98ca Date: 2026-04-03

gene-expression microglia neurodegeneration statistics tau
📊 Sleep disruption as cause and consequence of neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Sleep Disruption as Cause and Consequence of Neurodegeneration

How do sleep disruptions both drive and result from neurodegenerative disease processes, and what therapeutic opportunities exist in this bidirectional relationship?

gene-expression microglia neurodegeneration statistics tau
📊 Sleep disruption as cause and consequence of neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

RNA binding protein dysregulation across ALS FTD and AD

Analysis ID: SDA-2026-04-01-gap-v2-68d9c9c1

gene-expression neurodegeneration statistics
📊 RNA binding protein dysregulation across ALS FTD and AD (neurodegeneration)
Created: 2026-04-01
View Notebook →

Synaptic pruning by microglia in early AD — Gene Expression & Pathway Analysis

Analysis ID: SDA-2026-04-01-gap-v2-691b42f1 Date: 2026-04-03 Focus: complement-mediated synaptic elimination in early Alzheimer pathology

gene-expression microglia neurodegeneration statistics
📊 Synaptic pruning by microglia in early AD (neurodegeneration)
Created: 2026-04-01
View Notebook →

Synaptic pruning by microglia in early AD — Statistical Deep Dive

Analysis ID: SDA-2026-04-01-gap-v2-691b42f1 Date: 2026-04-03

gene-expression microglia neurodegeneration statistics
📊 Synaptic pruning by microglia in early AD (neurodegeneration)
Created: 2026-04-01
View Notebook →

Synaptic pruning by microglia in early AD

Analysis ID: SDA-2026-04-01-gap-v2-691b42f1

gene-expression microglia neurodegeneration statistics
📊 Synaptic pruning by microglia in early AD (neurodegeneration)
Created: 2026-04-01
View Notebook →

Mitochondrial transfer between astrocytes and neurons

Analysis ID: SDA-2026-04-01-gap-v2-89432b95

gene-expression neurodegeneration
📊 Mitochondrial transfer between astrocytes and neurons (neurodegeneration)
Created: 2026-04-01
View Notebook →

Epigenetic clocks and biological aging in neurodegeneration

What are the mechanisms underlying epigenetic clocks and biological aging in neurodegeneration?

epigenetics gene-expression neurodegeneration statistics
📊 Epigenetic clocks and biological aging in neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Perivascular Spaces and Glymphatic Clearance Failure in AD

How do perivascular space dysfunction and glymphatic clearance failure contribute to Alzheimer's disease pathogenesis?

gene-expression neurodegeneration statistics
📊 Perivascular spaces and glymphatic clearance failure in AD (neurodegeneration)
Created: 2026-04-01
View Notebook →

TREM2 agonism vs antagonism in DAM microglia

Analysis ID: SDA-2026-04-01-gap-001 Date: 2026-04-01 Domain: neurodegeneration Key Hypotheses: - TREM2-Dependent Microglial Senescence Transition (score: 0.705) - Cell-Type Specific TREM

SEA-AD gene-expression hypothesis-analysis knowledge-gap microglia
📊 TREM2 agonism vs antagonism in DAM microglia (neurodegeneration)
Created: 2026-04-01
View Notebook →

Selective vulnerability of entorhinal cortex layer II neurons in AD

Analysis ID: SDA-2026-04-01-gap-004 Date: 2026-04-01 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 83

SEA-AD gene-expression hypothesis-analysis knowledge-gap microglia
📊 Selective vulnerability of entorhinal cortex layer II neurons in AD (neurodegeneration)
Created: 2026-04-01
View Notebook →

4R-tau strain-specific spreading patterns in PSP vs CBD

Analysis ID: SDA-2026-04-01-gap-005 Date: 2026-04-01 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 112

SEA-AD gene-expression hypothesis-analysis knowledge-gap microglia
📊 4R-tau strain-specific spreading patterns in PSP vs CBD (neurodegeneration)
Created: 2026-04-01
View Notebook →

TDP-43 phase separation therapeutics for ALS-FTD

What are the mechanisms underlying tdp-43 phase separation therapeutics for als-ftd?

gene-expression hypothesis-analysis neurodegeneration statistics
📊 TDP-43 phase separation therapeutics for ALS-FTD (neurodegeneration)
Created: 2026-04-01
View Notebook →

Astrocyte reactivity subtypes in neurodegeneration

Analysis ID: SDA-2026-04-01-gap-007 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 20

SEA-AD epigenetics gene-expression hypothesis-analysis microglia
📊 Astrocyte reactivity subtypes in neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Blood-brain barrier transport mechanisms for antibody therapeutics

Analysis ID: SDA-2026-04-01-gap-008 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 20

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Blood-brain barrier transport mechanisms for antibody therapeutics (neurodegeneration)
Created: 2026-04-01
View Notebook →

Microglia-astrocyte crosstalk amplification loops in neurodegeneration

Analysis ID: SDA-2026-04-01-gap-009 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 20

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Microglia-astrocyte crosstalk amplification loops in neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

APOE4 structural biology and therapeutic targeting strategies

Analysis ID: SDA-2026-04-01-gap-010 Date: 2026-04-01 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 81

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 APOE4 structural biology and therapeutic targeting strategies (neurodegeneration)
Created: 2026-04-01
View Notebook →

Autophagy-lysosome pathway convergence across neurodegenerative diseases

What are the mechanisms underlying autophagy-lysosome pathway convergence across neurodegenerative diseases?

gene-expression hypothesis-analysis neurodegeneration statistics
📊 Autophagy-lysosome pathway convergence across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-01
View Notebook →

Digital biomarkers and AI-driven early detection of neurodegeneration

Analysis ID: SDA-2026-04-01-gap-012 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 20

SEA-AD biomarkers gene-expression hypothesis-analysis microglia
📊 Digital biomarkers and AI-driven early detection of neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Senolytic therapy for age-related neurodegeneration

Analysis ID: SDA-2026-04-01-gap-013 Date: 2026-04-01 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 282

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Senolytic therapy for age-related neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis?

What are the mechanisms underlying what are the mechanisms by which gut microbiome dysbiosis influences parkinson's disease pathogenesis through the gut-brain axis??

gene-expression hypothesis-analysis neurodegeneration statistics
📊 What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? (neurodegeneration)
Created: 2026-04-01
View Notebook →

Mitochondrial transfer between neurons and glia

Analysis ID: SDA-2026-04-01-gap-20260401231108 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 0

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Mitochondrial transfer between neurons and glia (neurodegeneration)
Created: 2026-04-01
View Notebook →

Mechanistic role of APOE in neurodegeneration

What are the mechanisms underlying mechanistic role of apoe in neurodegeneration?

gene-expression hypothesis-analysis lipid-rafts neurodegeneration statistics
📊 Mechanistic role of APOE in neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Lipid raft composition changes in synaptic neurodegeneration

Investigate how lipid raft composition (cholesterol metabolism, sphingolipids) changes in synaptic membranes during neurodegeneration and their mechanistic role in amyloid-beta processing and synapse

gene-expression hypothesis-analysis lipid-rafts neurodegeneration statistics
📊 Lipid raft composition changes in synaptic neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Sleep disruption as cause and consequence of neurodegeneration

What are the mechanisms underlying sleep disruption as cause and consequence of neurodegeneration?

gene-expression hypothesis-analysis microglia neurodegeneration statistics
📊 Sleep disruption as cause and consequence of neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

RNA binding protein dysregulation across ALS FTD and AD

What are the mechanisms underlying rna binding protein dysregulation across als ftd and ad?

gene-expression hypothesis-analysis neurodegeneration statistics
📊 RNA binding protein dysregulation across ALS FTD and AD (neurodegeneration)
Created: 2026-04-01
View Notebook →

Synaptic pruning by microglia in early AD

What are the mechanisms underlying synaptic pruning by microglia in early ad?

gene-expression hypothesis-analysis microglia neurodegeneration statistics
📊 Synaptic pruning by microglia in early AD (neurodegeneration)
Created: 2026-04-01
View Notebook →

Perivascular spaces and glymphatic clearance failure in AD

What are the mechanisms underlying perivascular spaces and glymphatic clearance failure in ad?

gene-expression hypothesis-analysis neurodegeneration statistics
📊 Perivascular spaces and glymphatic clearance failure in AD (neurodegeneration)
Created: 2026-04-01
View Notebook →