Notebook Artifact Registry

Computational analysis artifacts linked to analyses and knowledge graph entities

AllAPOE4AgingAllen InstituteAlzheimer'sCRISPRCircuit AnalysisCross-Age AnalysisEpigeneticsGene ExpressionImmune ResponseMicrogliaMouse ModelNeural DynamicsNeurodegenerationNeuroinflammationProtein PropagationSEA-ADSenescent CellsSenolyticsStructural BiologyTauTherapeutics[]agingalzheimersanalysisartifactastrocytesautobiomarkerscell-typescidraftepigeneticsforge-toolsgene-editinggene-expressionhypothesis-analysisknowledge-gaplipid-raftsmicroglianeurodegenerationneuroinflammationneuronsnotebooksea-adseededsenescenceshowcasesingle-cellstatisticsstubtautranscriptomicswalkthrough

🌟 Spotlight Notebooks

Neuroinflammation and Microglial Priming in Early Alzheimer's Disease

Real Forge-powered analysis: PubMed search, STRING PPI, Reactome pathways, gene annotations for microglial priming in early AD.

showcase forge-tools neuroinflammation neurodegeneration
📊 Neuroinflammation and microglial priming in early Alzheimer's Disease
Created: 2026-04-16
View Notebook →

Gene Expression Changes in Aging Mouse Brain Predicting Neurodegenerative Vulnerability

Real Forge-powered analysis: PubMed search, STRING PPI, Reactome pathways, gene annotations for aging mouse brain transcriptomics.

showcase forge-tools transcriptomics neurodegeneration
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability
Created: 2026-04-16
View Notebook →

CRISPR-Based Therapeutic Approaches for Neurodegenerative Diseases

Real Forge-powered analysis: PubMed search, STRING PPI, Reactome pathways, gene annotations for CRISPR neurodegeneration therapy research.

showcase forge-tools gene-editing neurodegeneration
📊 CRISPR-based therapeutic approaches for neurodegenerative diseases
Created: 2026-04-16
View Notebook →

Mitochondrial Dysfunction as a Driver of Neurodegeneration

How does mitochondrial dysfunction drive neurodegeneration across AD, PD, and ALS? Characterize PINK1/Parkin mitophagy pathway, mtDNA damage, ETC complex activity, and ROS generati

[]
Created: 2026-04-12
View Notebook →

Tau Pathology Propagation in Tauopathies — Mechanistic Dissection

How does misfolded tau spread through the brain in tauopathies? Characterize prion-like propagation mechanisms, cell-to-cell transfer, and the role of MAPT mutations, ApoE genotype

[]
Created: 2026-04-12
View Notebook →

All Notebooks (516)

What determines the optimal timing and dosing of ketogenic interventions for neuroprotection? - Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-03-gap-debate-20260403-222618-2709aad9. While ketone metabolism was discussed as therapeutic, the debate revealed no clear framework for when and ho

analysis auto ci
📊 What determines the optimal timing and dosing of ketogenic interventions for neuroprotection? (metabolic neuroscience)
Created: 2026-04-16
View Notebook →

What amyloid threshold level is required for optimal clinical benefit in early AD? - Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-16-gap-pubmed-20260410-192526-f2bbb9ab. While the study demonstrates dose-response relationships between amyloid levels and outcomes, it doesn't est

analysis auto ci
📊 What amyloid threshold level is required for optimal clinical benefit in early AD? (neurodegeneration)
Created: 2026-04-16

Which metabolic biomarkers can distinguish therapeutic response from disease progression in neurodegeneration trials? - Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-gap-debate-20260403-222618-c698b06a. The debate discussed various metabolic interventions but lacked clear endpoints for clinical translation. Wi

analysis auto ci
📊 Which metabolic biomarkers can distinguish therapeutic response from disease progression in neurodegeneration trials? (translational neuroscience)
Created: 2026-04-16
View Notebook →

Does LRRK2's role as a lysosomal volume sensor explain the pathogenic mechanism of disease-linked LRRK2 mutations? - Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-16-gap-pubmed-20260410-170027-a1e5f867. While the study establishes LRRK2 as a lysosomal swelling sensor and notes that lysosomal swelling occurs in

analysis auto ci
📊 Does LRRK2's role as a lysosomal volume sensor explain the pathogenic mechanism of disease-linked LRRK2 mutations? (neurodegeneration)
Created: 2026-04-16

Why have numerous phase 3 clinical trials failed despite advances in understanding AD pathobiology? - Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-16-gap-pubmed-20260410-145418-c1527e7b. There's a clear disconnect between improved mechanistic understanding of AD and therapeutic success, with co

draft auto ci
📊 Why have numerous phase 3 clinical trials failed despite advances in understanding AD pathobiology? (neurodegeneration)
Created: 2026-04-16

Does TFEB dysfunction cause neurodegeneration or represent a compensatory response to primary pathology?

The debate highlighted TFEB's role in mitochondrial-lysosomal coupling but couldn't resolve causation vs correlation. This distinction is critical for determining whether TFEB should be therapeuticall

seeded
Created: 2026-04-16
View Notebook →

APOE4 structural biology and therapeutic targeting strategies

**Analysis ID:** `sda-2026-04-01-gap-010` **Domain:** neurodegeneration **Status:** completed

seeded
Created: 2026-04-16
View Notebook →

Does reduced Prevotellaceae abundance cause PD pathology or result from it?

**Analysis ID:** `SDA-2026-04-11-gap-debate-20260410-111558-f9487fea` **Domain:** neurodegeneration **Status:** completed

seeded
Created: 2026-04-16
View Notebook →

Blood-brain barrier transport mechanisms for antibody therapeutics

**Analysis ID:** `sda-2026-04-01-gap-008` **Domain:** neurodegeneration **Status:** completed

seeded
Created: 2026-04-16
View Notebook →

Why do clinical manifestations overlap despite distinct underlying etiologies in immune-mediated myelopathies?

The abstract notes that clinical presentations overlap across different myelopathy etiologies, but the mechanistic basis for this convergent phenotype is not explained. Resolving this could improve di

seeded
Created: 2026-04-16
View Notebook →

Neuroinflammation and Microglial Priming in Early Alzheimer's Disease

> *Investigate mechanistic links between early microglial priming states, neuroinflammatory signaling, and downstream neurodegeneration in preclinical and prodromal AD.*

seeded
Created: 2026-04-16
View Notebook →

GBA-Synuclein Loop: Therapeutic Strategies for Parkinson's Disease

**Analysis ID:** `gba-pd` **Domain:** neurodegeneration **Status:** completed

seeded
Created: 2026-04-16
View Notebook →

Senolytic therapy for age-related neurodegeneration

**Analysis ID:** `sda-2026-04-01-gap-013` **Domain:** neurodegeneration **Status:** completed

seeded
Created: 2026-04-16
View Notebook →

Mechanistic role of APOE in neurodegeneration

**Analysis ID:** `sda-2026-04-01-gap-auto-fd6b1635d9` **Domain:** neurodegeneration **Status:** completed

seeded
Created: 2026-04-16
View Notebook →

CRISPR-Based Therapeutic Approaches for Neurodegenerative Diseases

**Analysis ID:** `SDA-2026-04-03-gap-crispr-neurodegeneration-20260402` **Domain:** Neurodegeneration **Research Question:** Evaluate the potential of CRISPR/Cas9 and related gene-editing technologies

seeded
Created: 2026-04-16
View Notebook →

Autophagy-lysosome pathway convergence across neurodegenerative diseases

**Analysis ID:** `sda-2026-04-01-gap-011` **Domain:** neurodegeneration **Status:** completed

seeded
Created: 2026-04-16
View Notebook →

Aging Mouse Brain × SEA-AD: Cross-Species Comparative Analysis

What genes, pathways, and mechanisms are shared between age-dependent changes in the mouse brain and cell-type-specific vulnerabilities in human Alzheimer's disease? How does aging serve as a mechanis

seeded
Created: 2026-04-16
View Notebook →

Systemic immune profiling and peripheral immune contributions to neurodegeneration

How do peripheral immune system alterations influence CNS pathology and neurodegeneration in Alzheimer disease? Examine: (1) peripheral monocyte/macrophage trafficking across the blood-brain barrier,

seeded
Created: 2026-04-16
View Notebook →

Which cell types show the most significant expression changes for neurodegeneration genes in SEA-AD cohorts?

The debate mentioned gene expression profiling but did not specify which neural cell populations (neurons, microglia, astrocytes, oligodendrocytes) exhibit the most pronounced alterations. This cellul

seeded
Created: 2026-04-16
View Notebook →

TREM2 Therapeutic Strategy Post-INVOKE-2

**Analysis ID:** `sda-2026-04-01-001` **Domain:** neurodegeneration **Status:** completed

seeded
Created: 2026-04-16
View Notebook →

Senescent cell clearance as neurodegeneration therapy

**Analysis ID:** `SDA-2026-04-04-gap-senescent-clearance-neuro` **Domain:** neurodegeneration **Status:** completed

seeded
Created: 2026-04-16
View Notebook →

What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis?

**Analysis ID:** `sda-2026-04-01-gap-20260401-225149` **Domain:** neurodegeneration **Status:** completed

seeded
Created: 2026-04-16
View Notebook →

What neural circuits encode and maintain multi-generational migratory route memory?

The paper describes memory-based migration routes maintained across generations but doesn't explain the neural substrate for this long-term spatial memory storage and transmission. This represents a m

seeded
Created: 2026-04-16
View Notebook →

Immune atlas neuroinflammation analysis in neurodegeneration

Comprehensive analysis of immune cell subtypes in neurodegeneration: microglia subtypes (DAM, homeostatic, inflammatory), astrocyte reactivity states, T-cell infiltration. Anchor to existing TREM2 (h-

seeded
Created: 2026-04-16
View Notebook →

SEA-AD Cell-Type Vulnerability Analysis

**Analysis ID**: SDA-2026-04-03-gap-seaad-v4-20260402065846 **Quest**: Demo Showcase (Quest 16) — D16.2 **Date**: 2026-04-03 **Status**: Completed (4-round multi-agent debate)

seeded
Created: 2026-04-16
View Notebook →

Cell type vulnerability in Alzheimer's Disease (SEA-AD data)

**Analysis ID:** `SDA-2026-04-03-gap-seaad-20260402025452` **Domain:** neurodegeneration **Status:** completed

seeded
Created: 2026-04-16
View Notebook →

RNA binding protein dysregulation across ALS FTD and AD

**Analysis ID:** `sda-2026-04-01-gap-v2-68d9c9c1` **Date:** 2026-04-02 **Domain:** neurodegeneration **Primary Cell Type:** Motor_Neurons **Hypotheses Generated:** 7 **Knowledge Graph Edges:** 20 ###

seeded
Created: 2026-04-16
View Notebook →

Neuroinflammation resolution mechanisms and pro-resolving mediators

**Analysis ID:** `sda-2026-04-01-gap-014` **Domain:** neurodegeneration **Status:** completed

seeded
Created: 2026-04-16
View Notebook →

GBA-Synuclein Loop Therapeutics for PD

**Analysis ID:** `sda-2026-04-01-002` **Domain:** neurodegeneration **Status:** completed

seeded
Created: 2026-04-16
View Notebook →

Epigenetic clocks and biological aging in neurodegeneration

**Analysis ID:** `sda-2026-04-01-gap-v2-bc5f270e` **Domain:** neurodegeneration **Status:** completed

seeded
Created: 2026-04-16
View Notebook →

Gene Expression Changes in Aging Mouse Brain Predicting Neurodegenerative Vulnerability

> What gene expression changes in the aging mouse brain predict neurodegenerative vulnerability? > Use Allen Aging Mouse Brain Atlas data. Cross-reference with human AD datasets. > Produce hypotheses

seeded
Created: 2026-04-16
View Notebook →

Lipid metabolism dysregulation and membrane integrity in Alzheimer disease

**Analysis ID:** `SDA-2026-04-04-frontier-lipidomics-dcdbc360` **Domain:** neurodegeneration **Status:** completed

seeded
Created: 2026-04-16
View Notebook →

Cell type vulnerability in Alzheimer's Disease (SEA-AD data - v2)

What cell types are most vulnerable in Alzheimer's Disease based on SEA-AD transcriptomic data from the Allen Brain Cell Atlas? Identify mechanisms of cell-type-specific vulnerability in neurons, micr

seeded
Created: 2026-04-16
View Notebook →

Astrocyte reactivity subtypes in neurodegeneration

**Analysis ID:** `sda-2026-04-01-gap-007` **Domain:** neurodegeneration **Status:** completed

seeded
Created: 2026-04-16
View Notebook →

4R-tau strain-specific spreading patterns in PSP vs CBD

**Analysis ID:** `sda-2026-04-01-gap-005` **Date:** 2026-04-02 **Domain:** neurodegeneration **Primary Cell Type:** Astrocytes **Hypotheses Generated:** 7 **Knowledge Graph Edges:** 20 ### Key Hypothe

seeded
Created: 2026-04-16
View Notebook →

Epigenetic reprogramming in aging neurons

Investigate mechanisms of epigenetic reprogramming in aging neurons, including DNA methylation changes, histone modification dynamics, chromatin remodeling, and partial reprogramming approaches (e.g.,

seeded
Created: 2026-04-16
View Notebook →

Can nanobodies achieve selective membrane penetration into tau-containing vesicles without affecting normal cellular vesicles?

The debate identified vesicle accessibility as a major concern for nanobody approaches but provided no evidence for selective membrane penetration. This technical barrier could invalidate the entire n

seeded
Created: 2026-04-16
View Notebook →

Sleep disruption as cause and consequence of neurodegeneration

**Analysis ID:** `sda-2026-04-01-gap-v2-18cf98ca` **Domain:** neurodegeneration **Status:** completed

seeded
Created: 2026-04-16
View Notebook →

Gut-Brain Axis Therapeutics for AD

**Analysis ID:** `sda-2026-04-01-003` **Domain:** neurodegeneration **Status:** completed

seeded
Created: 2026-04-16
View Notebook →

Which specific metabolic pathways in APOE4+ microglia are most therapeutically tractable?

While APOE4 disrupts microglial metabolism broadly, the debate didn't identify which specific disrupted pathways offer the best therapeutic targets. This prioritization is needed for focused drug deve

seeded
Created: 2026-04-16
View Notebook →

Neuroinflammation and microglial priming in early AD

**Analysis ID:** `SDA-2026-04-04-gap-neuroinflammation-microglial-20260404` **Domain:** neurodegeneration **Status:** completed

seeded
Created: 2026-04-16
View Notebook →

Circuit-level neural dynamics in neurodegeneration

**Analysis ID:** `SDA-2026-04-03-26abc5e5f9f2` **Domain:** neuroscience **Status:** completed

seeded
Created: 2026-04-16
View Notebook →

Synaptic pruning by microglia in early AD

**Analysis ID:** `sda-2026-04-01-gap-v2-691b42f1` **Domain:** neurodegeneration **Status:** completed

seeded
Created: 2026-04-16
View Notebook →

What are the minimal structural requirements for HSP70/HSP90 inhibitors to achieve tau-selectivity over essential cellular functions?

The debate highlighted broad cellular toxicity of existing HSP inhibitors but did not resolve how to engineer selectivity for tau-associated chaperones. This structure-activity relationship gap preven

seeded
Created: 2026-04-16
View Notebook →

SEA-AD Single-Cell Analysis: Cell-Type Vulnerability in Alzheimer's Disease

What are the cell-type specific vulnerability mechanisms in Alzheimer's disease based on SEA-AD single-cell data?

seeded
Created: 2026-04-16
View Notebook →

Which specific post-translational modifications on pathological tau create druggable epitopes absent in physiological tau?

The debate mentioned tau PTM targeting but did not identify which modifications are both disease-specific and accessible for therapeutic intervention. This knowledge gap limits the development of PTM-

seeded
Created: 2026-04-16
View Notebook →

Quantitative proteomics of the aging synapse in early Alzheimer disease

What are the critical protein expression changes and post-translational modifications (phosphorylation, ubiquitination, glycosylation) at the aging synapse that drive early Alzheimer disease pathophys

seeded
Created: 2026-04-16
View Notebook →

Tau propagation mechanisms and therapeutic interception points

**Analysis ID:** `SDA-2026-04-04-gap-tau-prop-20260402003221` **Date:** 2026-04-02 **Domain:** neurodegeneration **Primary Cell Type:** Microglia **Hypotheses Generated:** 7 **Knowledge Graph Edges:**

seeded
Created: 2026-04-16
View Notebook →

TDP-43 phase separation therapeutics for ALS-FTD

**Analysis ID:** `sda-2026-04-01-gap-006` **Domain:** neurodegeneration **Status:** completed

seeded
Created: 2026-04-16
View Notebook →

Protein aggregation cross-seeding across neurodegenerative diseases

**Analysis ID:** `sda-2026-04-01-gap-9137255b` **Date:** 2026-04-02 **Domain:** neurodegeneration **Primary Cell Type:** Neurons **Hypotheses Generated:** 7 **Knowledge Graph Edges:** 20 ### Key Hypot

seeded
Created: 2026-04-16
View Notebook →

Selective vulnerability of entorhinal cortex layer II neurons in AD

**Analysis ID:** `sda-2026-04-01-gap-004` **Domain:** neurodegeneration **Status:** completed

seeded
Created: 2026-04-16
View Notebook →

What is the actual quantitative contribution of FcRn-mediated transcytosis to BBB antibody transport in humans?

The debate revealed conflicting estimates ranging from <5% to 20% for FcRn's role in BBB transport, with species differences unresolved. This fundamental uncertainty undermines rational design of FcRn

seeded
Created: 2026-04-16
View Notebook →

Mitochondrial transfer between neurons and glia

**Analysis ID:** `sda-2026-04-01-gap-20260401231108` **Date:** 2026-04-02 **Domain:** neurodegeneration **Primary Cell Type:** Astrocytes **Hypotheses Generated:** 7 **Knowledge Graph Edges:** 20 ###

seeded
Created: 2026-04-16
View Notebook →

Mitochondrial transfer between astrocytes and neurons

**Analysis ID:** `sda-2026-04-01-gap-v2-89432b95` **Domain:** neurodegeneration **Status:** completed

seeded
Created: 2026-04-16
View Notebook →

Human connectome alterations and network-level dysfunction in Alzheimer disease

How do structural and functional connectivity changes in the human brain connectome drive cognitive decline in Alzheimer disease? Investigate: (1) default mode network disruption and amyloid depositio

seeded
Created: 2026-04-16
View Notebook →

Gut-Brain Axis Therapeutics for Alzheimer's Disease

**Analysis ID:** `gut-brain-ad` **Domain:** neurodegeneration **Status:** completed

seeded
Created: 2026-04-16
View Notebook →

Do tau-containing vesicles exhibit unique surface glycosylation patterns that distinguish them from normal vesicles?

The debate proposed targeting vesicle surface glycans but acknowledged no published data demonstrates unique glycosylation patterns on tau-containing vesicles. This fundamental question must be resolv

seeded
Created: 2026-04-16
View Notebook →

Digital biomarkers and AI-driven early detection of neurodegeneration

**Analysis ID:** `sda-2026-04-01-gap-012` **Domain:** neurodegeneration **Status:** completed

seeded
Created: 2026-04-16
View Notebook →

Perivascular spaces and glymphatic clearance failure in AD

**Analysis ID:** `sda-2026-04-01-gap-v2-ee5a5023` **Domain:** neurodegeneration **Status:** completed

seeded
Created: 2026-04-16
View Notebook →

Microglia-astrocyte crosstalk amplification loops in neurodegeneration

**Analysis ID:** `sda-2026-04-01-gap-009` **Domain:** neurodegeneration **Status:** completed

seeded
Created: 2026-04-16
View Notebook →

Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability - Notebook

Analysis notebook for: Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability

📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-16
View Notebook →

Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability - Notebook

Analysis notebook for: Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability

📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-16
View Notebook →

Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability - Notebook

Analysis notebook for: Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability

📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-16
View Notebook →

Cell type vulnerability in Alzheimer's Disease (SEA-AD data) - Notebook

Analysis notebook for: Cell type vulnerability in Alzheimer's Disease (SEA-AD data)

📊 Cell type vulnerability in Alzheimer's Disease (SEA-AD data) (neurodegeneration)
Created: 2026-04-16
View Notebook →

Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability - Notebook

Analysis notebook for: Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability

📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-16
View Notebook →

Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability - Notebook

Analysis notebook for: Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability

📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-16
View Notebook →

Investigate prion-like spreading of tau pathology through connected brain regions - Notebook

Analysis notebook for: Investigate prion-like spreading of tau pathology through connected brain regions

📊 Investigate prion-like spreading of tau pathology through connected brain regions (neurodegeneration)
Created: 2026-04-16
View Notebook →

epigenetic reprogramming aging neurons - Notebook

Analysis notebook for: epigenetic reprogramming aging neurons

📊 epigenetic reprogramming aging neurons (neurodegeneration)
Created: 2026-04-16
View Notebook →

APOE4-driven lipid metabolism dysregulation in astrocytes and its role in AD - Notebook

Analysis notebook for: APOE4-driven lipid metabolism dysregulation in astrocytes and its role in AD

📊 APOE4-driven lipid metabolism dysregulation in astrocytes and its role in AD (neuroscience)
Created: 2026-04-16
View Notebook →

Unable to extract research questions - transcript appears to be empty - Notebook

Analysis notebook for: Unable to extract research questions - transcript appears to be empty

📊 Unable to extract research questions - transcript appears to be empty (methodology)
Created: 2026-04-16
View Notebook →

Neuroinflammation and microglial priming in early Alzheimer's Disease - Notebook

Analysis notebook for: Neuroinflammation and microglial priming in early Alzheimer's Disease

📊 Neuroinflammation and microglial priming in early Alzheimer's Disease (neurodegeneration)
Created: 2026-04-16
View Notebook →

How do disease-associated mutations in G3BP1 or its binding partners alter stress granule dynamics? - Notebook

Analysis notebook for: How do disease-associated mutations in G3BP1 or its binding partners alter stress granule dynamics?

📊 How do disease-associated mutations in G3BP1 or its binding partners alter stress granule dynamics? (neurodegeneration)
Created: 2026-04-16
View Notebook →

Which neural cell types exhibit the most pronounced gene expression alterations in neurodegeneration? - Notebook

Analysis notebook for: Which neural cell types exhibit the most pronounced gene expression alterations in neurodegeneration?

📊 Which neural cell types exhibit the most pronounced gene expression alterations in neurodegeneration? (neurodegeneration)
Created: 2026-04-16
View Notebook →

Which specific cell types show greatest vulnerability in AD based on SEA-AD transcriptomic analysis? - Notebook

Analysis notebook for: Which specific cell types show greatest vulnerability in AD based on SEA-AD transcriptomic analysis?

📊 Which specific cell types show greatest vulnerability in AD based on SEA-AD transcriptomic analysis? (neurodegeneration)
Created: 2026-04-16
View Notebook →

What specific gene expression signatures in aging mouse white matter predict human AD vulnerability? - Notebook

Analysis notebook for: What specific gene expression signatures in aging mouse white matter predict human AD vulnerability?

📊 What specific gene expression signatures in aging mouse white matter predict human AD vulnerability? (neurodegeneration)
Created: 2026-04-16
View Notebook →

How can Allen Aging Mouse Brain Atlas data be systematically cross-referenced with human AD datasets to identify conserved vulnerability markers? - Notebook

Analysis notebook for: How can Allen Aging Mouse Brain Atlas data be systematically cross-referenced with human AD datasets to identify conserved vulnerability markers?

📊 How can Allen Aging Mouse Brain Atlas data be systematically cross-referenced with human AD datasets to identify conserved vulnerability markers? (neurodegeneration)
Created: 2026-04-16
View Notebook →

What specific gene expression signatures in aging mouse brain predict human AD vulnerability? - Notebook

Analysis notebook for: What specific gene expression signatures in aging mouse brain predict human AD vulnerability?

📊 What specific gene expression signatures in aging mouse brain predict human AD vulnerability? (neurodegeneration)
Created: 2026-04-16
View Notebook →

What are the molecular signatures that distinguish protective vs. harmful microglial states across AD, PD, and ALS? - Notebook

Analysis notebook for: What are the molecular signatures that distinguish protective vs. harmful microglial states across AD, PD, and ALS?

📊 What are the molecular signatures that distinguish protective vs. harmful microglial states across AD, PD, and ALS? (neurodegeneration)
Created: 2026-04-16
View Notebook →

What is the temporal sequence of sleep disruption versus amyloid-beta accumulation in preclinical neurodegeneration? - Notebook

Analysis notebook for: What is the temporal sequence of sleep disruption versus amyloid-beta accumulation in preclinical neurodegeneration?

📊 What is the temporal sequence of sleep disruption versus amyloid-beta accumulation in preclinical neurodegeneration? (neurodegeneration)
Created: 2026-04-16
View Notebook →

Astrocyte Reactivity Subtypes in Neurodegeneration - Notebook

Analysis notebook for: Astrocyte Reactivity Subtypes in Neurodegeneration

📊 Astrocyte Reactivity Subtypes in Neurodegeneration (neurodegeneration)
Created: 2026-04-16
View Notebook →

What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? - Notebook

Analysis notebook for: What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis?

📊 What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? (neurodegeneration)
Created: 2026-04-16
View Notebook →

TREM2 Therapeutic Strategy Post-INVOKE-2 - Notebook

Analysis notebook for: TREM2 Therapeutic Strategy Post-INVOKE-2

📊 TREM2 Therapeutic Strategy Post-INVOKE-2 (neurodegeneration)
Created: 2026-04-16
View Notebook →

Neuroinflammation and Microglial Priming in Early Alzheimer's Disease

Real Forge-powered analysis: PubMed search, STRING PPI, Reactome pathways, gene annotations for microglial priming in early AD.

showcase forge-tools neuroinflammation neurodegeneration
📊 Neuroinflammation and microglial priming in early Alzheimer's Disease (neurodegeneration)
Created: 2026-04-16
View Notebook →

Senescent cell clearance as neurodegeneration therapy — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-gap-senescent-clearance-neuro. Investigate the therapeutic potential of clearing senescent cells (senolytics) to slow or reverse neurodegeneratio

analysis auto ci
📊 Senescent cell clearance as neurodegeneration therapy (neurodegeneration)
Created: 2026-04-16
View Notebook →

Gene Expression Changes in Aging Mouse Brain Predicting Neurodegenerative Vulnerability

Real Forge-powered analysis: PubMed search, STRING PPI, Reactome pathways, gene annotations for aging mouse brain transcriptomics.

showcase forge-tools transcriptomics neurodegeneration
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-16
View Notebook →

CRISPR-Based Therapeutic Approaches for Neurodegenerative Diseases

Real Forge-powered analysis: PubMed search, STRING PPI, Reactome pathways, gene annotations for CRISPR neurodegeneration therapy research.

showcase forge-tools gene-editing neurodegeneration
📊 CRISPR-based therapeutic approaches for neurodegenerative diseases (neurodegeneration)
Created: 2026-04-16
View Notebook →

SEA-AD Gene Expression Profiling — Allen Brain Cell Atlas — Analysis Notebook

CI-generated notebook stub for analysis analysis-SEAAD-20260402. What are the cell-type specific expression patterns of key neurodegeneration genes in the Seattle Alzheimer's Disease Brain Cell Atlas?

analysis auto ci
📊 SEA-AD Gene Expression Profiling — Allen Brain Cell Atlas (neurodegeneration)
Created: 2026-04-16
View Notebook →

Is APOE4's reduced lipid binding pathogenic or a compensatory evolutionary adaptation? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-16-gap-debate-20260410-113104-a13caf2e. The skeptic raised evidence that APOE4 carriers show enhanced cholesterol synthesis, suggesting the lipid bi

analysis auto ci
📊 Is APOE4's reduced lipid binding pathogenic or a compensatory evolutionary adaptation? (molecular biology)
Created: 2026-04-16
View Notebook →

Does TRPML1 enhancement cause therapeutic benefit or paradoxical lysosomal dysfunction in vivo? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-16-gap-debate-20260410-113045-27c7b314. The debate revealed conflicting evidence about whether TRPML1 activation rescues or worsens lysosomal functi

analysis auto ci
📊 Does TRPML1 enhancement cause therapeutic benefit or paradoxical lysosomal dysfunction in vivo? (neurodegeneration)
Created: 2026-04-16
View Notebook →

Blood-brain barrier tight junction disruption by neuroinflammatory cytokines — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-16-gap-bbb-tjp-20260416041707. Analyze how neuroinflammatory cascades disrupt blood-brain barrier (BBB) integrity through tight junction protein deg

analysis auto ci
📊 Blood-brain barrier tight junction disruption by neuroinflammatory cytokines (neurodegeneration)
Created: 2026-04-16
View Notebook →

test debate — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-15-gap-20260415-221737. test debate [TARGET_ARTIFACT type=experiment id=exp-123]

analysis auto ci
📊 test debate (neurodegeneration)
Created: 2026-04-16
View Notebook →

How do sphingomyelin/ceramide ratios specifically regulate BACE1 clustering and activity in synaptic vs non-synaptic lipid rafts? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-15-gap-debate-20260410-112819-e40e0fa2. The debate established that ceramide accumulation affects amyloid-β processing but didn't resolve the spatia

analysis auto ci
📊 How do sphingomyelin/ceramide ratios specifically regulate BACE1 clustering and activity in synaptic vs non-synaptic lipid rafts? (neurodegeneration)
Created: 2026-04-16
View Notebook →

What are the specific molecular determinants that govern tau strain selection during prion-like propagation? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-15-gap-debate-20260410-112730-24052bbe. The debate highlighted tau prion-like transmission but did not resolve how different tau conformations compe

analysis auto ci
📊 What are the specific molecular determinants that govern tau strain selection during prion-like propagation? (neurodegeneration)
Created: 2026-04-16
View Notebook →

What are the cell-type-specific transcriptomic signatures of vulnerability in SEA-AD data? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-15-gap-debate-20260410-112607-0a3749ea. Despite the debate focusing on SEA-AD transcriptomic data, no actual gene expression patterns or pathway ana

analysis auto ci
📊 What are the cell-type-specific transcriptomic signatures of vulnerability in SEA-AD data? (neurodegeneration)
Created: 2026-04-16
View Notebook →

How do synthetic EVs achieve brain-specific targeting while avoiding reticuloendothelial clearance? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-15-gap-debate-20260410-112545-377c1d9e. All participants identified brain delivery as a critical barrier, but no mechanism was proposed for overcomi

analysis auto ci
📊 How do synthetic EVs achieve brain-specific targeting while avoiding reticuloendothelial clearance? (drug delivery)
Created: 2026-04-16
View Notebook →

Are age-related static epigenetic patterns pathogenic or protective compensatory mechanisms? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-15-gap-debate-20260410-112539-31f47880. The debate assumed static 5-hydroxymethylcytosine patterns in aging neurons are harmful, but the skeptic rai

analysis auto ci
📊 Are age-related static epigenetic patterns pathogenic or protective compensatory mechanisms? (epigenetics)
Created: 2026-04-16
View Notebook →

What determines the GPX4/ACSL4 balance that switches microglia from protective to ferroptotic states? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-15-gap-debate-20260410-112528-782f5aa2. While ACSL4-driven ferroptosis was strongly supported, the molecular triggers that tip the balance from prot

analysis auto ci
📊 What determines the GPX4/ACSL4 balance that switches microglia from protective to ferroptotic states? (immunology)
Created: 2026-04-16
View Notebook →

What molecular mechanisms mediate SPP1-induced microglial phagocytic activation and synaptic targeting? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-15-gap-pubmed-20260406-062118-e3613755. The study shows SPP1 from perivascular cells drives microglial synaptic engulfment, but the specific recepto

analysis auto ci
📊 What molecular mechanisms mediate SPP1-induced microglial phagocytic activation and synaptic targeting? (neuroinflammation)
Created: 2026-04-16
View Notebook →

What is the temporal sequence of TREM2 signaling transition from protective to inflammatory during aging? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-15-gap-debate-20260410-112522-57d1cc4f. While TREM2 was identified as critical for microglial senescence, the debate lacked fine-grained temporal da

analysis auto ci
📊 What is the temporal sequence of TREM2 signaling transition from protective to inflammatory during aging? (neuroimmunology)
Created: 2026-04-16
View Notebook →

Are interneuron oscillation deficits compensatory responses or primary pathological drivers in neurodegeneration? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-15-gap-debate-20260410-112441-f2afffb3. The debate raised whether SST/PV interneuron dysfunction represents adaptive compensation to maintain circui

analysis auto ci
📊 Are interneuron oscillation deficits compensatory responses or primary pathological drivers in neurodegeneration? (neurodegeneration)
Created: 2026-04-16
View Notebook →

Do CXCL10-recruited CD8+ T cells provide neuroprotection or cause damage in aging white matter? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-15-gap-debate-20260410-112400-454036f1. The debate revealed contradictory evidence about CD8+ T cell roles in neurodegeneration, with some studies s

analysis auto ci
📊 Do CXCL10-recruited CD8+ T cells provide neuroprotection or cause damage in aging white matter? (neuroimmunology)
Created: 2026-04-16
View Notebook →

What are the precise temporal dynamics of astrocyte ketone production decline during neurodegeneration progression? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-15-gap-debate-20260410-112330-9abf86eb. The debate identified a critical therapeutic window when astrocytic ketone production declines but neurons r

analysis auto ci
📊 What are the precise temporal dynamics of astrocyte ketone production decline during neurodegeneration progression? (neurodegeneration)
Created: 2026-04-16
View Notebook →

Should microtubule-stabilizing drugs be reconsidered as therapeutic targets for tauopathies given tau's destabilizing role? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-15-gap-pubmed-20260410-100455-ff18091d. The abstract challenges the rationale for using microtubule-stabilizing drugs in tau diseases, since tau app

analysis auto ci
📊 Should microtubule-stabilizing drugs be reconsidered as therapeutic targets for tauopathies given tau's destabilizing role? (neurodegeneration)
Created: 2026-04-16
View Notebook →

How does engineered C. butyricum cross the blood-brain barrier to directly bind GLP-1 receptors? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-15-gap-pubmed-20260411-093924-7330920b. The abstract claims C. butyricum-GLP-1 crosses the BBB and binds to GLP-1 receptors, but this is mechanistic

analysis auto ci
📊 How does engineered C. butyricum cross the blood-brain barrier to directly bind GLP-1 receptors? (neurodegeneration)
Created: 2026-04-16
View Notebook →

What is the therapeutic window between insufficient and toxic levels of TDP-43 arginine methylation? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-12-gap-debate-20260410-113051-5dce7651. The debate highlighted a critical dosing paradox where both hypo- and hypermethylation could be harmful, but

analysis auto ci
📊 What is the therapeutic window between insufficient and toxic levels of TDP-43 arginine methylation? (neurodegeneration)
Created: 2026-04-16
View Notebook →

What is the relative contribution of connexin-43 gap junctions vs tunneling nanotubes to mitochondrial transfer? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-12-gap-debate-20260410-113038-57244485. The debate revealed conflicting evidence about whether connexin-43 mediates mitochondrial transfer through g

analysis auto ci
📊 What is the relative contribution of connexin-43 gap junctions vs tunneling nanotubes to mitochondrial transfer? (cell biology)
Created: 2026-04-16
View Notebook →

Do SCFAs directly modulate α-synuclein aggregation in vivo at physiologically relevant brain concentrations? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-12-gap-debate-20260410-113021-6fbc6da4. The debate identified a critical mechanistic gap between SCFA production by gut bacteria and α-synuclein dis

analysis auto ci
📊 Do SCFAs directly modulate α-synuclein aggregation in vivo at physiologically relevant brain concentrations? (neurodegeneration)
Created: 2026-04-16
View Notebook →

What is the actual quantitative contribution of FcRn-mediated transcytosis to BBB antibody transport in humans? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-12-gap-debate-20260410-112908-13c403ee. The debate revealed conflicting estimates ranging from <5% to 20% for FcRn's role in BBB transport, with spe

analysis auto ci
📊 What is the actual quantitative contribution of FcRn-mediated transcytosis to BBB antibody transport in humans? (neuropharmacology)
Created: 2026-04-16
View Notebook →

Does reduced Prevotellaceae abundance cause PD pathology or result from it? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-11-gap-debate-20260410-111558-f9487fea. Does reduced Prevotellaceae abundance cause PD pathology or result from it?

analysis auto ci
📊 Does reduced Prevotellaceae abundance cause PD pathology or result from it? (neurodegeneration)
Created: 2026-04-16
View Notebook →

Lipid metabolism dysregulation and membrane integrity in Alzheimer disease — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-frontier-lipidomics-dcdbc360. How do alterations in brain lipid metabolism—including gangliosides, phospholipids, cholesterol transport, and sphi

analysis auto ci
📊 Lipid metabolism dysregulation and membrane integrity in Alzheimer disease (neurodegeneration)
Created: 2026-04-16
View Notebook →

Systemic immune profiling and peripheral immune contributions to neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-frontier-immunomics-e6f97b29. How do peripheral immune system alterations influence CNS pathology and neurodegeneration in Alzheimer disease? Exa

analysis auto ci
📊 Systemic immune profiling and peripheral immune contributions to neurodegeneration (neurodegeneration)
Created: 2026-04-16
View Notebook →

Human connectome alterations and network-level dysfunction in Alzheimer disease — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-frontier-connectomics-84acb35a. How do structural and functional connectivity changes in the human brain connectome drive cognitive decline in Al

analysis auto ci
📊 Human connectome alterations and network-level dysfunction in Alzheimer disease (neurodegeneration)
Created: 2026-04-16

Quantitative proteomics of the aging synapse in early Alzheimer disease — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-frontier-proteomics-1c3dba72. What are the critical protein expression changes and post-translational modifications (phosphorylation, ubiquitinat

analysis auto ci
📊 Quantitative proteomics of the aging synapse in early Alzheimer disease (neurodegeneration)
Created: 2026-04-16

Can nanobodies achieve selective membrane penetration into tau-containing vesicles without affecting normal cellular vesicles? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-09-gap-debate-20260409-201742-ca7016f1. The debate identified vesicle accessibility as a major concern for nanobody approaches but provided no evide

analysis auto ci
📊 Can nanobodies achieve selective membrane penetration into tau-containing vesicles without affecting normal cellular vesicles? (molecular biology)
Created: 2026-04-16

Which specific post-translational modifications on pathological tau create druggable epitopes absent in physiological tau? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-09-gap-debate-20260409-201742-1e8eb3bd. The debate mentioned tau PTM targeting but did not identify which modifications are both disease-specific an

analysis auto ci
📊 Which specific post-translational modifications on pathological tau create druggable epitopes absent in physiological tau? (neurodegeneration)
Created: 2026-04-16

Do tau-containing vesicles exhibit unique surface glycosylation patterns that distinguish them from normal vesicles? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-09-gap-debate-20260409-201742-d279750b. The debate proposed targeting vesicle surface glycans but acknowledged no published data demonstrates unique

analysis auto ci
📊 Do tau-containing vesicles exhibit unique surface glycosylation patterns that distinguish them from normal vesicles? (neurodegeneration)
Created: 2026-04-16

What are the minimal structural requirements for HSP70/HSP90 inhibitors to achieve tau-selectivity over essential cellular functions? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-09-gap-debate-20260409-201742-5407d57d. The debate highlighted broad cellular toxicity of existing HSP inhibitors but did not resolve how to enginee

analysis auto ci
📊 What are the minimal structural requirements for HSP70/HSP90 inhibitors to achieve tau-selectivity over essential cellular functions? (drug discovery)
Created: 2026-04-16

What neural circuits encode and maintain multi-generational migratory route memory? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-08-gap-pubmed-20260406-062218-5c7f15f4. The paper describes memory-based migration routes maintained across generations but doesn't explain the neur

analysis auto ci
📊 What neural circuits encode and maintain multi-generational migratory route memory? (spatial memory)
Created: 2026-04-16
View Notebook →

Why do clinical manifestations overlap despite distinct underlying etiologies in immune-mediated myelopathies? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-08-gap-pubmed-20260406-062111-db808ee9. The abstract notes that clinical presentations overlap across different myelopathy etiologies, but the mecha

analysis auto ci
📊 Why do clinical manifestations overlap despite distinct underlying etiologies in immune-mediated myelopathies? (neuroinflammation)
Created: 2026-04-16
View Notebook →

Which specific metabolic pathways in APOE4+ microglia are most therapeutically tractable? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-08-gap-debate-20260406-062033-fecb8755. While APOE4 disrupts microglial metabolism broadly, the debate didn't identify which specific disrupted path

analysis auto ci
📊 Which specific metabolic pathways in APOE4+ microglia are most therapeutically tractable? (neurodegeneration)
Created: 2026-04-16
View Notebook →

How does ADCY8 mechanistically regulate long-term memory formation in migratory navigation? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-08-gap-pubmed-20260406-062218-580b17ef. The study identifies ADCY8 as associated with migratory distance differences and suggests long-term memory a

analysis auto ci
📊 How does ADCY8 mechanistically regulate long-term memory formation in migratory navigation? (memory and navigation)
Created: 2026-04-16
View Notebook →

What determines the selectivity and efficiency of intercellular transmission pathways for different misfolded proteins? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-08-gap-pubmed-20260406-062207-5a703c17. While the abstract establishes that intercellular transmission occurs for various proteins (tau, α-synuclein

analysis auto ci
📊 What determines the selectivity and efficiency of intercellular transmission pathways for different misfolded proteins? (neurodegeneration)
Created: 2026-04-16
View Notebook →

Why does prolonged anesthesia cause both cognitive dysfunction and anxiety through the same synaptic mechanism? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-08-gap-pubmed-20260406-062128-34a47c4e. The study reports that complement-mediated synaptic elimination produces both cognitive deficits and anxiety

analysis auto ci
📊 Why does prolonged anesthesia cause both cognitive dysfunction and anxiety through the same synaptic mechanism? (neurodegeneration)
Created: 2026-04-16
View Notebook →

How does SPI1 transcriptionally regulate C1QA and C1QC expression in atherosclerotic contexts? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-08-gap-pubmed-20260406-062122-bfac06c8. The authors identify SPI1 as a potential transcription factor regulating the hub genes but provide no mechan

analysis auto ci
📊 How does SPI1 transcriptionally regulate C1QA and C1QC expression in atherosclerotic contexts? (neuroinflammation)
Created: 2026-04-16
View Notebook →

Can metabolic interventions truly reverse established cellular senescence or only prevent progression? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-08-gap-debate-20260406-062101-7751c220. The highest-ranked hypothesis assumes senescence reversibility through metabolic reprogramming, but the deba

analysis auto ci
📊 Can metabolic interventions truly reverse established cellular senescence or only prevent progression? (cell biology)
Created: 2026-04-16
View Notebook →

How can ESCRT or SNARE targeting achieve tau-specific effects without disrupting essential cellular processes? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-08-gap-debate-20260406-062052-81a54bfd. The debate identified fundamental druggability challenges for these targets due to their essential roles, bu

analysis auto ci
📊 How can ESCRT or SNARE targeting achieve tau-specific effects without disrupting essential cellular processes? (molecular biology)
Created: 2026-04-16
View Notebook →

Why do systemic anti-inflammatory drugs fail in AD despite cardiovascular efficacy if neuroinflammation is central? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-08-gap-debate-20260406-062045-ce866189. The debate noted clinical failures of TNF-α and IL-6 inhibitors in AD despite their cardiovascular success a

analysis auto ci
📊 Why do systemic anti-inflammatory drugs fail in AD despite cardiovascular efficacy if neuroinflammation is central? (clinical neurology)
Created: 2026-04-16
View Notebook →

Do different priming stimuli require distinct therapeutic approaches or share common epigenetic pathways? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-08-gap-debate-20260406-062039-f02efa4b. The skeptic proposed that epigenetic modifiers should work equally well regardless of initial priming stimul

analysis auto ci
📊 Do different priming stimuli require distinct therapeutic approaches or share common epigenetic pathways? (immunology)
Created: 2026-04-16
View Notebook →

Can circadian interventions reverse microglial priming independent of sleep disruption effects? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-08-gap-debate-20260406-062033-16eccec1. The debate highlighted that sleep disruption affects multiple systems simultaneously, creating confounding v

analysis auto ci
📊 Can circadian interventions reverse microglial priming independent of sleep disruption effects? (chronobiology)
Created: 2026-04-16
View Notebook →

How do non-cell autonomous effects of autophagy dysfunction contribute to ALS pathogenesis? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-08-gap-pubmed-20260406-062212-b66510d9. The authors explicitly state that the manner and extent to which autophagy dysfunction in non-neuronal cells

analysis auto ci
📊 How do non-cell autonomous effects of autophagy dysfunction contribute to ALS pathogenesis? (neurodegeneration)
Created: 2026-04-16
View Notebook →

How do host cell factors influence the conformation and propagation properties of transmitted pathological seeds? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-08-gap-pubmed-20260406-062207-b800e5d3. The abstract acknowledges that host cells influence seed properties, but the specific cellular factors and m

analysis auto ci
📊 How do host cell factors influence the conformation and propagation properties of transmitted pathological seeds? (neurodegeneration)
Created: 2026-04-16
View Notebook →

What determines the specificity of DDR protein recruitment to dilncRNA-induced condensates? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-08-gap-pubmed-20260406-062229-3ab00c95. While the study shows 53BP1 forms phase-separated foci driven by dilncRNAs, it's unclear what molecular feat

analysis auto ci
📊 What determines the specificity of DDR protein recruitment to dilncRNA-induced condensates? (neurodegeneration)
Created: 2026-04-16
View Notebook →

How do protein-protein interactions determine subcellular localization and function specificity? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-08-gap-pubmed-20260406-062222-cc3bcb47. While the abstract mentions identifying subcellular roles of protein interactions, the mechanistic principle

analysis auto ci
📊 How do protein-protein interactions determine subcellular localization and function specificity? (synaptic biology)
Created: 2026-04-16
View Notebook →

How do dilncRNAs specifically drive molecular crowding and phase separation of DDR proteins? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-08-gap-pubmed-20260406-062229-35a642ca. The abstract shows that dilncRNAs drive molecular crowding of DDR proteins into phase-separated condensates,

analysis auto ci
📊 How do dilncRNAs specifically drive molecular crowding and phase separation of DDR proteins? (neurodegeneration)
Created: 2026-04-16
View Notebook →

What molecular mechanisms drive tissue-specific phenotypes in Mendelian neurological diseases? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-08-gap-pubmed-20260406-062222-b5f44522. The abstract identifies tissue-specific networks that may underlie Mendelian disease phenotypes but doesn't

analysis auto ci
📊 What molecular mechanisms drive tissue-specific phenotypes in Mendelian neurological diseases? (neurodegeneration)
Created: 2026-04-16
View Notebook →

Epigenetic reprogramming in aging neurons — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-gap-epigenetic-reprog-b685190e. Investigate mechanisms of epigenetic reprogramming in aging neurons, including DNA methylation changes, histone m

analysis auto ci
📊 Epigenetic reprogramming in aging neurons (neurodegeneration)
Created: 2026-04-16
View Notebook →

Neuroinflammation and microglial priming in early AD — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-gap-neuroinflammation-microglial-20260404. How does microglial priming contribute to early Alzheimer's disease pathology? Focus on the mechanisms

analysis auto ci
📊 Neuroinflammation and microglial priming in early AD (neurodegeneration)
Created: 2026-04-16
View Notebook →

Tau propagation mechanisms and therapeutic interception points — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-gap-tau-prop-20260402003221. Investigate prion-like spreading of tau pathology through connected brain regions, focusing on trans-synaptic transf

analysis auto ci
📊 Tau propagation mechanisms and therapeutic interception points (neurodegeneration)
Created: 2026-04-16
View Notebook →

SEA-AD Single-Cell Analysis: Cell-Type Vulnerability in Alzheimer's Disease — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-analysis_sea_ad_001. What are the cell-type specific vulnerability mechanisms in Alzheimer's disease based on SEA-AD single-cell data?

analysis auto ci
📊 SEA-AD Single-Cell Analysis: Cell-Type Vulnerability in Alzheimer's Disease (neurodegeneration)
Created: 2026-04-16
View Notebook →

Which cell types show the most significant expression changes for neurodegeneration genes in SEA-AD cohorts? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-03-gap-debate-20260403-222543-20260402. The debate mentioned gene expression profiling but did not specify which neural cell populations (neurons, m

analysis auto ci
📊 Which cell types show the most significant expression changes for neurodegeneration genes in SEA-AD cohorts? (neurodegeneration)
Created: 2026-04-16
View Notebook →

Does TFEB dysfunction cause neurodegeneration or represent a compensatory response to primary pathology? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-03-gap-debate-20260403-222617-8eb5bdbc. The debate highlighted TFEB's role in mitochondrial-lysosomal coupling but couldn't resolve causation vs cor

analysis auto ci
📊 Does TFEB dysfunction cause neurodegeneration or represent a compensatory response to primary pathology? (neurodegeneration)
Created: 2026-04-16
View Notebook →

Immune atlas neuroinflammation analysis in neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-03-gap-immune-atlas-neuroinflam-20260402. Comprehensive analysis of immune cell subtypes in neurodegeneration: microglia subtypes (DAM, homeostatic,

analysis auto ci
📊 Immune atlas neuroinflammation analysis in neurodegeneration (Neuroinflammation)
Created: 2026-04-16
View Notebook →

Cell type vulnerability in Alzheimer's Disease (SEA-AD data) — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-03-gap-seaad-20260402025452. What cell types are most vulnerable in Alzheimers Disease based on SEA-AD transcriptomic data? Use Allen Brain Cell Atl

analysis auto ci
📊 Cell type vulnerability in Alzheimer's Disease (SEA-AD data) (neurodegeneration)
Created: 2026-04-16
View Notebook →

Circuit-level neural dynamics in neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-03-26abc5e5f9f2. Analyze circuit-level changes in neurodegeneration using Allen Institute Neural Dynamics data. Focus on: (1) hippocampal circuit di

analysis auto ci
📊 Circuit-level neural dynamics in neurodegeneration (neuroscience)
Created: 2026-04-16
View Notebook →

Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-03-gap-seaad-v4-20260402065846. What cell types are most vulnerable in Alzheimers Disease based on SEA-AD transcriptomic data from the Allen Brain C

analysis auto ci
📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-16
View Notebook →

Cell type vulnerability in Alzheimer's Disease (SEA-AD data - v2) — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-03-gap-seaad-v2-20260402032945. What cell types are most vulnerable in Alzheimer's Disease based on SEA-AD transcriptomic data from the Allen Brain

analysis auto ci
📊 Cell type vulnerability in Alzheimer's Disease (SEA-AD data - v2) (neurodegeneration)
Created: 2026-04-16
View Notebook →

Extracellular vesicle biomarkers for early AD detection — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-02-gap-ev-ad-biomarkers. Extracellular vesicles (EVs), including exosomes and microvesicles, carry molecular cargo (proteins, miRNAs, lipids) from t

analysis auto ci
📊 Extracellular vesicle biomarkers for early AD detection (neurodegeneration)
Created: 2026-04-16
View Notebook →

Metabolic reprogramming in neurodegenerative disease — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-02-gap-v2-5d0e3052. How does metabolic reprogramming (glucose metabolism shifts, brain insulin resistance, ketone body utilization) affect neuronal

analysis auto ci
📊 Metabolic reprogramming in neurodegenerative disease (neurodegeneration)
Created: 2026-04-16
View Notebook →

Epigenetic clocks and biological aging in neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-v2-bc5f270e. Epigenetic clocks and biological aging in neurodegeneration

analysis auto ci
📊 Epigenetic clocks and biological aging in neurodegeneration (neurodegeneration)
Created: 2026-04-16
View Notebook →

Sleep disruption as cause and consequence of neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-v2-18cf98ca. Sleep disruption as cause and consequence of neurodegeneration

analysis auto ci
📊 Sleep disruption as cause and consequence of neurodegeneration (neurodegeneration)
Created: 2026-04-16
View Notebook →

Mitochondrial transfer between astrocytes and neurons — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-v2-89432b95. Mitochondrial transfer between astrocytes and neurons

analysis auto ci
📊 Mitochondrial transfer between astrocytes and neurons (neurodegeneration)
Created: 2026-04-16
View Notebook →

RNA binding protein dysregulation across ALS FTD and AD — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-v2-68d9c9c1. RNA binding protein dysregulation across ALS FTD and AD

analysis auto ci
📊 RNA binding protein dysregulation across ALS FTD and AD (neurodegeneration)
Created: 2026-04-16
View Notebook →

Perivascular spaces and glymphatic clearance failure in AD — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-v2-ee5a5023. Perivascular spaces and glymphatic clearance failure in AD

analysis auto ci
📊 Perivascular spaces and glymphatic clearance failure in AD (neurodegeneration)
Created: 2026-04-16
View Notebook →

Synaptic pruning by microglia in early AD — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-v2-691b42f1. Synaptic pruning by microglia in early AD

analysis auto ci
📊 Synaptic pruning by microglia in early AD (neurodegeneration)
Created: 2026-04-16
View Notebook →

Neuroinflammation resolution mechanisms and pro-resolving mediators — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-014. SPMs (resolvins, protectins, maresins) from omega-3s may promote inflammation resolution. Are resolution failures druggable?

analysis auto ci
📊 Neuroinflammation resolution mechanisms and pro-resolving mediators (neurodegeneration)
Created: 2026-04-16
View Notebook →

Digital biomarkers and AI-driven early detection of neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-012. Can speech, gait, retinal imaging, sleep, and smartphone data detect neurodegeneration 5-10 years before diagnosis?

analysis auto ci
📊 Digital biomarkers and AI-driven early detection of neurodegeneration (neurodegeneration)
Created: 2026-04-16
View Notebook →

Senolytic therapy for age-related neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-013. Senolytics targeting p16/p21+ senescent astrocytes and microglia may reduce SASP-driven neuroinflammation.

analysis auto ci
📊 Senolytic therapy for age-related neurodegeneration (neurodegeneration)
Created: 2026-04-16
View Notebook →

Autophagy-lysosome pathway convergence across neurodegenerative diseases — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-011. Multiple NDDs converge on autophagy-lysosome dysfunction. Are there universal therapeutic targets?

analysis auto ci
📊 Autophagy-lysosome pathway convergence across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-16
View Notebook →

Microglia-astrocyte crosstalk amplification loops in neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-009. Microglia activate astrocytes via IL-1alpha/TNF/C1q, and reactive astrocytes feed back to microglia via complement/chemokines.

analysis auto ci
📊 Microglia-astrocyte crosstalk amplification loops in neurodegeneration (neurodegeneration)
Created: 2026-04-16
View Notebook →

APOE4 structural biology and therapeutic targeting strategies — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-010. APOE4 differs from APOE3 by C112R causing domain interaction that alters lipid binding and amyloid clearance.

analysis auto ci
📊 APOE4 structural biology and therapeutic targeting strategies (neurodegeneration)
Created: 2026-04-16
View Notebook →

TDP-43 phase separation therapeutics for ALS-FTD — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-006. TDP-43 undergoes liquid-liquid phase separation that becomes pathological. Small molecules targeting phase separation properties could b

analysis auto ci
📊 TDP-43 phase separation therapeutics for ALS-FTD (neurodegeneration)
Created: 2026-04-16
View Notebook →

Astrocyte reactivity subtypes in neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-007. Astrocytes adopt A1 (neurotoxic) and A2 (neuroprotective) phenotypes, but recent single-cell data reveals far greater heterogeneity. Map

analysis auto ci
📊 Astrocyte reactivity subtypes in neurodegeneration (neurodegeneration)
Created: 2026-04-16
View Notebook →

4R-tau strain-specific spreading patterns in PSP vs CBD — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-005. PSP and CBD both involve 4R-tau but produce distinct neuropathological patterns (tufted astrocytes vs astrocytic plaques). Whether tau s

analysis auto ci
📊 4R-tau strain-specific spreading patterns in PSP vs CBD (neurodegeneration)
Created: 2026-04-16
View Notebook →

Selective vulnerability of entorhinal cortex layer II neurons in AD — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-004. Why do entorhinal cortex layer II stellate neurons die first in AD? Their unique electrophysiological properties, grid cell function, an

analysis auto ci
📊 Selective vulnerability of entorhinal cortex layer II neurons in AD (neurodegeneration)
Created: 2026-04-16
View Notebook →

Blood-brain barrier transport mechanisms for antibody therapeutics — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-008. Anti-amyloid antibodies (lecanemab, donanemab) have ~0.1% brain penetrance. Engineering improved BBB transcytosis via transferrin recept

analysis auto ci
📊 Blood-brain barrier transport mechanisms for antibody therapeutics (neurodegeneration)
Created: 2026-04-16
View Notebook →

Lipid raft composition changes in synaptic neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-01-gap-lipid-rafts-2026-04-01. Investigate how lipid raft composition (cholesterol metabolism, sphingolipids) changes in synaptic membranes during n

analysis auto ci
📊 Lipid raft composition changes in synaptic neurodegeneration (neurodegeneration)
Created: 2026-04-16
View Notebook →

GBA-Synuclein Loop: Therapeutic Strategies for Parkinson's Disease — Analysis Notebook

CI-generated notebook stub for analysis gba-pd. GBA-Synuclein Loop: Therapeutic Strategies for Parkinson's Disease?

analysis auto ci
📊 GBA-Synuclein Loop: Therapeutic Strategies for Parkinson's Disease (neurodegeneration)
Created: 2026-04-16
View Notebook →

Gut-Brain Axis Therapeutics for Alzheimer's Disease — Analysis Notebook

CI-generated notebook stub for analysis gut-brain-ad. Gut-Brain Axis Therapeutics for Alzheimer's Disease?

analysis auto ci
📊 Gut-Brain Axis Therapeutics for Alzheimer's Disease (neurodegeneration)
Created: 2026-04-16
View Notebook →

What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-20260401-225149. What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain

analysis auto ci
📊 What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? (neurodegeneration)
Created: 2026-04-16
View Notebook →

Mitochondrial transfer between neurons and glia — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-20260401231108. Mitochondrial transfer between neurons and glia?

analysis auto ci
📊 Mitochondrial transfer between neurons and glia (neurodegeneration)
Created: 2026-04-16
View Notebook →

Protein aggregation cross-seeding across neurodegenerative diseases — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-9137255b. Protein aggregation cross-seeding across neurodegenerative diseases?

analysis auto ci
📊 Protein aggregation cross-seeding across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-16
View Notebook →

Mechanistic role of APOE in neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-auto-fd6b1635d9. Mechanistic role of APOE in neurodegeneration?

analysis auto ci
📊 Mechanistic role of APOE in neurodegeneration (neurodegeneration)
Created: 2026-04-16
View Notebook →

Do β-amyloid plaques and neurofibrillary tangles cause or result from cholinergic dysfunction? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-12-20260411-082446-2c1c9e2d. The abstract explicitly questions whether AD's hallmark pathologies induce cholinergic dysfunction or vice versa. This

analysis auto ci
📊 Do β-amyloid plaques and neurofibrillary tangles cause or result from cholinergic dysfunction? (neurodegeneration)
Created: 2026-04-16
View Notebook →

Do bacterial curli amyloids cross the blood-brain barrier to directly seed α-synuclein aggregation in humans? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-12-gap-debate-20260410-112927-b4535f82. Do bacterial curli amyloids cross the blood-brain barrier to directly seed α-synuclein aggregation in humans

analysis auto ci
📊 Do bacterial curli amyloids cross the blood-brain barrier to directly seed α-synuclein aggregation in humans? (neurodegeneration)
Created: 2026-04-16
View Notebook →

Why have numerous phase 3 clinical trials failed despite advances in understanding AD pathobiology? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-12-gap-debate-20260410-145418-c1527e7b. Why have numerous phase 3 clinical trials failed despite advances in understanding AD pathobiology?

analysis auto ci
📊 Why have numerous phase 3 clinical trials failed despite advances in understanding AD pathobiology? (neurodegeneration)
Created: 2026-04-16
View Notebook →

How does APOE4's beneficial immune function reconcile with its established role as the strongest AD risk factor? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-12-gap-pubmed-20260410-184126-b2c3e2e8. How does APOE4's beneficial immune function reconcile with its established role as the strongest AD risk fac

analysis auto ci
📊 How does APOE4's beneficial immune function reconcile with its established role as the strongest AD risk factor? (neurodegeneration)
Created: 2026-04-16
View Notebook →

TREM2 Therapeutic Strategy Post-INVOKE-2 — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-001. What are the most promising therapeutic strategies for targeting TREM2 in Alzheimer's disease, given the INVOKE-2 failure?

analysis auto ci
📊 TREM2 Therapeutic Strategy Post-INVOKE-2 (neurodegeneration)
Created: 2026-04-16
View Notebook →

GBA-Synuclein Loop Therapeutics for PD — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-002. How to break the GBA-alpha-synuclein bidirectional loop for Parkinson's Disease therapy?

analysis auto ci
📊 GBA-Synuclein Loop Therapeutics for PD (neurodegeneration)
Created: 2026-04-16
View Notebook →

Gut-Brain Axis Therapeutics for AD — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-003. Can gut-brain axis modulation prevent or slow Alzheimer's disease pathology?

analysis auto ci
📊 Gut-Brain Axis Therapeutics for AD (neurodegeneration)
Created: 2026-04-16
View Notebook →

Extracellular vesicle biomarkers for early AD detection — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-12-ev-ad-biomarkers. Which EV-derived biomarkers (phospho-tau, amyloid-beta, synaptic proteins, inflammatory mediators) show the highest diagnostic

analysis auto ci
📊 Extracellular vesicle biomarkers for early AD detection (neurodegeneration)
Created: 2026-04-16
View Notebook →

Protein aggregation cross-seeding across neurodegenerative diseases - Rich Analysis Notebook

Rich analysis notebook with gene expression, pathway enrichment, radar scoring, and statistical tests for Protein aggregation cross-seeding across neurodegenerative diseases.

📊 Protein aggregation cross-seeding across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-16
View Notebook →

Mitochondrial transfer between neurons and glia - Rich Analysis Notebook

Rich analysis notebook with gene expression, pathway enrichment, radar scoring, and statistical tests for Mitochondrial transfer between neurons and glia.

📊 Mitochondrial transfer between neurons and glia (neurodegeneration)
Created: 2026-04-16
View Notebook →

RNA binding protein dysregulation across ALS FTD and AD - Rich Analysis Notebook

Rich analysis notebook with gene expression, pathway enrichment, radar scoring, and statistical tests for RNA binding protein dysregulation across ALS FTD and AD.

📊 RNA binding protein dysregulation across ALS FTD and AD (neurodegeneration)
Created: 2026-04-16
View Notebook →

4R-tau strain-specific spreading patterns in PSP vs CBD - Rich Analysis Notebook

Rich analysis notebook with gene expression, pathway enrichment, radar scoring, and statistical tests for 4R-tau strain-specific spreading patterns in PSP vs CBD.

📊 4R-tau strain-specific spreading patterns in PSP vs CBD (neurodegeneration)
Created: 2026-04-16
View Notebook →

What is the temporal sequence of sleep disruption versus amyloid-beta accumulation in preclinical neurodegeneration? — Analysis Notebook

No description

📊 What is the temporal sequence of sleep disruption versus amyloid-beta accumulation in preclinical neurodegeneration? (neurodegeneration)
Created: 2026-04-12

What are the molecular signatures that distinguish protective vs. harmful microglial states across AD, PD, and ALS? — Analysis Notebook

No description

📊 What are the molecular signatures that distinguish protective vs. harmful microglial states across AD, PD, and ALS? (neurodegeneration)
Created: 2026-04-12

What specific gene expression signatures in aging mouse brain predict human AD vulnerability? — Analysis Notebook

No description

📊 What specific gene expression signatures in aging mouse brain predict human AD vulnerability? (neurodegeneration)
Created: 2026-04-12

Mitochondrial Dysfunction as a Driver of Neurodegeneration

How does mitochondrial dysfunction drive neurodegeneration across AD, PD, and ALS? Characterize PINK1/Parkin mitophagy pathway, mtDNA damage, ETC complex activity, and ROS generation in disease-releva

[]
Created: 2026-04-12
View Notebook →

Tau Pathology Propagation in Tauopathies — Mechanistic Dissection

How does misfolded tau spread through the brain in tauopathies? Characterize prion-like propagation mechanisms, cell-to-cell transfer, and the role of MAPT mutations, ApoE genotype, and GBA in tau spr

[]
Created: 2026-04-12
View Notebook →

What are the optimal timing windows for TREM2 agonism vs antagonism across disease progression stages? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-11-gap-debate-20260410-112636-141592ba. The debate highlighted that TREM2 therapeutic targeting remains contested across disease stages, but no clea

draft auto ci
📊 What are the optimal timing windows for TREM2 agonism vs antagonism across disease progression stages? (neurodegeneration)
Created: 2026-04-12

How can CRISPR systems achieve persistent therapeutic effects while avoiding chronic immune responses to Cas proteins in the CNS? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-11-gap-debate-20260410-112625-c44578b5. The debate highlighted that long-term CRISPR expression triggers immune responses, but epigenetic therapies

draft auto ci
📊 How can CRISPR systems achieve persistent therapeutic effects while avoiding chronic immune responses to Cas proteins in the CNS? (gene therapy)
Created: 2026-04-12

Can P16INK4A expression reliably distinguish harmful from beneficial senescent microglia in neurodegeneration? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-11-gap-debate-20260410-112619-9c3c13d2. The debate proposed P16INK4A-guided targeting but the Skeptic noted microglia exist in complex activation st

draft auto ci
📊 Can P16INK4A expression reliably distinguish harmful from beneficial senescent microglia in neurodegeneration? (neurodegeneration)
Created: 2026-04-12

How can Allen Aging Mouse Brain Atlas data be systematically cross-referenced with human AD datasets to identify conserved vulnerability markers? — Analysis Notebook

No description

📊 How can Allen Aging Mouse Brain Atlas data be systematically cross-referenced with human AD datasets to identify conserved vulnerability markers? (neurodegeneration)
Created: 2026-04-11

What specific gene expression signatures in aging mouse white matter predict human AD vulnerability? — Analysis Notebook

No description

📊 What specific gene expression signatures in aging mouse white matter predict human AD vulnerability? (neurodegeneration)
Created: 2026-04-11

Which specific cell types show greatest vulnerability in AD based on SEA-AD transcriptomic analysis? — Analysis Notebook

No description

📊 Which specific cell types show greatest vulnerability in AD based on SEA-AD transcriptomic analysis? (neurodegeneration)
Created: 2026-04-11

Which neural cell types exhibit the most pronounced gene expression alterations in neurodegeneration? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-11-gap-debate-20260410-112336-ccdef571. The debate generated therapeutic hypotheses targeting different cell types but never resolved the fundamenta

draft auto ci
📊 Which neural cell types exhibit the most pronounced gene expression alterations in neurodegeneration? (neurodegeneration)
Created: 2026-04-11

Does SYK activation provide neuroprotection or exacerbate neuroinflammation in established Alzheimer's disease? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-11-gap-debate-20260410-111113-052488a8. The debate revealed fundamental uncertainty about whether enhancing TYROBP-SYK signaling would be beneficial

draft auto ci
📊 Does SYK activation provide neuroprotection or exacerbate neuroinflammation in established Alzheimer's disease? (neurodegeneration)
Created: 2026-04-11

Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-03-gap-aging-mouse-brain-v2-20260402. What gene expression changes in the aging mouse brain predict neurodegenerative vulnerability? Use Allen Aging

analysis auto ci
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-06
View Notebook →

How do disease-associated mutations in G3BP1 or its binding partners alter stress granule dynamics? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-06-gap-pubmed-20260406-041428-e14e6524. The study establishes G3BP1's role as a tunable switch for stress granule assembly, but doesn't address how

draft auto ci
📊 How do disease-associated mutations in G3BP1 or its binding partners alter stress granule dynamics? (neurodegeneration)
Created: 2026-04-06

Unable to extract research questions - transcript appears to be empty — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-gap-debate-20260403-222510-20260402. The provided transcript contains only speaker labels [Theorist] and [Synthesizer] with no actual debate cont

draft auto ci
📊 Unable to extract research questions - transcript appears to be empty (methodology)
Created: 2026-04-06
View Notebook →

Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-03-gap-aging-mouse-brain-20260402. What gene expression changes in the aging mouse brain predict neurodegenerative vulnerability? Use Allen Aging Mo

analysis auto ci
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-06
View Notebook →

SEA-AD Allen Brain Cell Atlas Analysis

Demonstrates Atlas layer capabilities through analysis of Seattle Alzheimer's Disease Brain Cell Atlas. Includes differential expression, cell type markers, and pathway analysis.

Created: 2026-04-06

TREM2 Gene Expression Analysis in AD

Cell-type specific analysis of TREM2 expression in Alzheimer's disease. Includes statistical testing, effect size analysis, and cross-dataset validation.

Created: 2026-04-06

Pathway Enrichment Analysis for AD Targets

Systematic pathway enrichment analysis of 25 top-scoring hypothesis targets from SciDEX. Identifies 12 significantly enriched pathways including amyloid processing, microglial activation, and lipid me

Created: 2026-04-06

TREM2 Therapeutic Strategy Post-INVOKE-2 — Analysis Notebook

Computational analysis notebook for 'TREM2 Therapeutic Strategy Post-INVOKE-2'. Domain: neurodegeneration. Research question: Analysis question not specified

analysis artifact notebook
📊 TREM2 Therapeutic Strategy Post-INVOKE-2 (neurodegeneration)
Created: 2026-04-04

What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? — Analysis Notebook

Computational analysis notebook for 'What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis?'. Domain: neurodegeneration. Rese

draft artifact notebook
📊 What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? (neurodegeneration)
Created: 2026-04-04

SEA-AD Cell-Type Vulnerability Analysis

Comprehensive single-cell analysis of Alzheimer's disease using Seattle Alzheimer's Disease Brain Cell Atlas data. Includes gene expression heatmaps, differential expression analysis, and mechanistic

alzheimers single-cell sea-ad cell-types microglia
TREM2 APOE GFAP MAPT Microglia
📊 SEA-AD Single-Cell Analysis: Cell-Type Vulnerability in Alzheimer's Disease (neurodegeneration)
Created: 2026-04-04
View Notebook →

ACSL4-Driven Ferroptotic Priming in Disease-Associated Microglia

Hypothesis ID: h-seaad-v4-26ba859b | Composite Score: 0.82/1.00

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
Created: 2026-04-04

Cell-Type Specific TREM2 Upregulation in DAM Microglia

Hypothesis ID: h-seaad-51323624 | Composite Score: 0.73/1.00

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
Created: 2026-04-04

Proteostasis Enhancement via APOE Chaperone Targeting

Hypothesis ID: h-5d943bfc | Composite Score: 0.74/1.00

gene-expression hypothesis-analysis neurodegeneration statistics
Created: 2026-04-04

APOE-Dependent Autophagy Restoration

Hypothesis ID: h-51e7234f | Composite Score: 0.80/1.00

gene-expression hypothesis-analysis neurodegeneration statistics
Created: 2026-04-04

Targeted Butyrate Supplementation for Microglial Phenotype Modulation

Hypothesis ID: h-3d545f4e | Composite Score: 0.79/1.00

gene-expression hypothesis-analysis microglia neurodegeneration statistics
Created: 2026-04-04

Gamma entrainment therapy to restore hippocampal-cortical synchrony

Hypothesis ID: h-bdbd2120

gene-expression hypothesis-analysis neurodegeneration statistics
Created: 2026-04-04

Aging Mouse Brain Atlas: Cross-Age Gene Expression Analysis

Identify age-related gene expression changes across hippocampus, cortex, and cerebellum to understand aging-neurodegeneration overlap

aging gene-expression neurodegeneration statistics
Created: 2026-04-04

SEA-AD Gene Expression Analysis: Microglia vs Neurons in Alzheimer's Disease

Notebook ID: SEA-AD-gene-expression-analysis

SEA-AD gene-expression microglia neurodegeneration statistics
Created: 2026-04-04

SEA-AD Single-Cell Analysis: Cell-Type Vulnerability in Alzheimer's Disease — Analysis Notebook

CI-generated notebook stub for analysis analysis_sea_ad_001. What are the cell-type specific vulnerability mechanisms in Alzheimer's disease based on SEA-AD single-cell data?

analysis auto ci
📊 SEA-AD Single-Cell Analysis: Cell-Type Vulnerability in Alzheimer's Disease (neurodegeneration)
Created: 2026-04-04
View Notebook →

APOE4-driven lipid metabolism dysregulation in astrocytes and its role in AD — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-gap-apoe4-lipid-metabolism. APOE4 is the strongest genetic risk factor for late-onset AD. How APOE4 specifically disrupts lipid homeostasis in as

draft auto ci
📊 APOE4-driven lipid metabolism dysregulation in astrocytes and its role in AD (neuroscience)
Created: 2026-04-04

epigenetic reprogramming aging neurons — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-gap-20260404-060512. epigenetic reprogramming aging neurons

draft auto ci
📊 epigenetic reprogramming aging neurons (neurodegeneration)
Created: 2026-04-04

Investigate prion-like spreading of tau pathology through connected brain regions — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-gap-20260404-052358. Investigate prion-like spreading of tau pathology through connected brain regions

draft auto ci
📊 Investigate prion-like spreading of tau pathology through connected brain regions (neurodegeneration)
Created: 2026-04-04

Astrocyte Reactivity Subtypes in Neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis astrocyte-subtypes. Analysis question not specified

analysis auto ci
📊 Astrocyte Reactivity Subtypes in Neurodegeneration (neurodegeneration)
Created: 2026-04-04

Neuroinflammation and microglial priming in early Alzheimer's Disease - Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-gap-neuro-microglia-early-ad-20260404. Investigate the role of neuroinflammation and microglial priming in the earliest stages of Alzheimer's Dis

analysis auto ci
📊 Neuroinflammation and microglial priming in early Alzheimer's Disease (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: H 4Bb7Fd8C

Computational notebook for h-4bb7fd8c

Created: 2026-04-04
View Notebook →

Top 5 Analysis: H Bdbd2120

Computational notebook for h-bdbd2120

Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 006

Computational notebook for SDA-2026-04-01-gap-006

SDA
📊 TDP-43 phase separation therapeutics for ALS-FTD (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Hyp Seaad V4 26Ba859B

Computational notebook for hyp-seaad-v4-26ba859b

Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 011 Expression

Computational notebook for SDA-2026-04-01-gap-011-expression

SDA
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 009 Expression

Computational notebook for SDA-2026-04-01-gap-009-expression

SDA
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap V2 691B42F1 Statistics

Computational notebook for SDA-2026-04-01-gap-v2-691b42f1-statistics

SDA
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 01 Gap 010

Computational notebook for SDA-2026-04-01-gap-010

SDA
📊 APOE4 structural biology and therapeutic targeting strategies (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 02 Gap Seaad V4 20260402065846

Computational notebook for SDA-2026-04-02-gap-seaad-v4-20260402065846

SDA
📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Analysis Seaad 20260402

Computational notebook for analysis-SEAAD-20260402

SEAAD
📊 SEA-AD Gene Expression Profiling — Allen Brain Cell Atlas (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 20260401 225155

Computational notebook for SDA-2026-04-01-gap-20260401-225155

SDA
📊 What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 01 Gap 012

Computational notebook for SDA-2026-04-01-gap-012

SDA
📊 Digital biomarkers and AI-driven early detection of neurodegeneration (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap V2 89432B95

Computational notebook for SDA-2026-04-01-gap-v2-89432b95

SDA
📊 Mitochondrial transfer between astrocytes and neurons (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 01 Gap 009

Computational notebook for SDA-2026-04-01-gap-009

SDA
📊 Microglia-astrocyte crosstalk amplification loops in neurodegeneration (neurodegeneration)
Created: 2026-04-04
View Notebook →

Aging Mouse Brain Atlas Analysis

Computational notebook for aging_mouse_brain_atlas_analysis

Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 02 Gap Crispr Neurodegeneration 20260402

Computational notebook for SDA-2026-04-02-gap-crispr-neurodegeneration-20260402

SDA
📊 CRISPR-based therapeutic approaches for neurodegenerative diseases (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Hyp Seaad 51323624

Computational notebook for hyp-seaad-51323624

Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 01 Gap 001

Computational notebook for SDA-2026-04-01-gap-001

SDA
📊 TREM2 agonism vs antagonism in DAM microglia (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap V2 Bc5F270E

Computational notebook for SDA-2026-04-01-gap-v2-bc5f270e

SDA
📊 Epigenetic clocks and biological aging in neurodegeneration (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 02 Gap Aging Mouse Brain 20260402

Computational notebook for SDA-2026-04-02-gap-aging-mouse-brain-20260402

SDA
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 01 Gap 004

Computational notebook for SDA-2026-04-01-gap-004

SDA
📊 Selective vulnerability of entorhinal cortex layer II neurons in AD (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 01 Gap 006

Computational notebook for SDA-2026-04-01-gap-006

SDA
📊 TDP-43 phase separation therapeutics for ALS-FTD (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 01 Gap V2 18Cf98Ca

Computational notebook for SDA-2026-04-01-gap-v2-18cf98ca

SDA
📊 Sleep disruption as cause and consequence of neurodegeneration (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 01 Gap V2 68D9C9C1

Computational notebook for SDA-2026-04-01-gap-v2-68d9c9c1

SDA
📊 RNA binding protein dysregulation across ALS FTD and AD (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 02 Gap Aging Mouse Brain 20260402

Computational notebook for SDA-2026-04-02-gap-aging-mouse-brain-20260402

SDA
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 02 Gap Immune Atlas Neuroinflam 20260402

Computational notebook for SDA-2026-04-02-gap-immune-atlas-neuroinflam-20260402

SDA
📊 Immune atlas neuroinflammation analysis in neurodegeneration (Neuroinflammation)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 02 Gap Ev Ad Biomarkers

Computational notebook for SDA-2026-04-02-gap-ev-ad-biomarkers

SDA
📊 Extracellular vesicle biomarkers for early AD detection (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 01 Gap 007

Computational notebook for SDA-2026-04-01-gap-007

SDA
📊 Astrocyte reactivity subtypes in neurodegeneration (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 02 Gap Seaad V2 20260402032945

Computational notebook for SDA-2026-04-02-gap-seaad-v2-20260402032945

SDA
📊 Cell type vulnerability in Alzheimer's Disease (SEA-AD data - v2) (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: H 4Fabd9Ce

Computational notebook for h-4fabd9ce

Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 004

Computational notebook for SDA-2026-04-01-gap-004

SDA
📊 Selective vulnerability of entorhinal cortex layer II neurons in AD (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 005

Computational notebook for SDA-2026-04-01-gap-005

SDA
📊 4R-tau strain-specific spreading patterns in PSP vs CBD (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 9137255B

Computational notebook for SDA-2026-04-01-gap-9137255b

SDA
📊 Protein aggregation cross-seeding across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 009

Computational notebook for SDA-2026-04-01-gap-009

SDA
📊 Microglia-astrocyte crosstalk amplification loops in neurodegeneration (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 006 Expression

Computational notebook for SDA-2026-04-01-gap-006-expression

SDA
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 02 Gap Aging Mouse Brain V5 20260402

Computational notebook for SDA-2026-04-02-gap-aging-mouse-brain-v5-20260402

SDA
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 01 Gap 013

Computational notebook for SDA-2026-04-01-gap-013

SDA
📊 Senolytic therapy for age-related neurodegeneration (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap V2 18Cf98Ca

Computational notebook for SDA-2026-04-01-gap-v2-18cf98ca

SDA
📊 Sleep disruption as cause and consequence of neurodegeneration (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap V2 18Cf98Ca Statistics

Computational notebook for SDA-2026-04-01-gap-v2-18cf98ca-statistics

SDA
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Hyp 3D545F4E

Computational notebook for hyp-3d545f4e

Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 02 Gap Epigenetic Reprog B685190E

Computational notebook for SDA-2026-04-02-gap-epigenetic-reprog-b685190e

SDA
📊 Epigenetic reprogramming in aging neurons (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 01 Gap 20260401231108

Computational notebook for SDA-2026-04-01-gap-20260401231108

SDA
📊 Mitochondrial transfer between neurons and glia (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 006 Statistics

Computational notebook for SDA-2026-04-01-gap-006-statistics

SDA
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 02 Gap Microglial Subtypes 20260402004119

Computational notebook for SDA-2026-04-02-gap-microglial-subtypes-20260402004119

SDA
📊 Microglial subtypes in neurodegeneration — friend vs foe (neuroscience)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: H 9E9Fee95

Computational notebook for h-9e9fee95

Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 02 26Abc5E5F9F2

Computational notebook for SDA-2026-04-02-26abc5e5f9f2

SDA
📊 Circuit-level neural dynamics in neurodegeneration (neuroscience)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 02 Gap V2 5D0E3052

Computational notebook for SDA-2026-04-02-gap-v2-5d0e3052

SDA
📊 Metabolic reprogramming in neurodegenerative disease (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: H 61196Ade

Computational notebook for h-61196ade

Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 011 Statistics

Computational notebook for SDA-2026-04-01-gap-011-statistics

SDA
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 02 Gap Senescent Clearance Neuro

Computational notebook for SDA-2026-04-02-gap-senescent-clearance-neuro

SDA
📊 Senescent cell clearance as neurodegeneration therapy (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 008

Computational notebook for SDA-2026-04-01-gap-008

SDA
📊 Blood-brain barrier transport mechanisms for antibody therapeutics (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 02 Gap Tau Prop 20260402003221

Computational notebook for SDA-2026-04-02-gap-tau-prop-20260402003221

SDA
📊 Tau propagation mechanisms and therapeutic interception points (neurodegeneration)
Created: 2026-04-04
View Notebook →

Analysis Seaad 20260402

Computational notebook for SEAAD-20260402

SEAAD
📊 Cell type vulnerability in Alzheimer's Disease (SEA-AD data) (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap V2 691B42F1 Expression

Computational notebook for SDA-2026-04-01-gap-v2-691b42f1-expression

SDA
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 02 Gap 20260402 003115

Computational notebook for SDA-2026-04-02-gap-20260402-003115

SDA
📊 Is disrupted sleep a cause or consequence of neurodegeneration? Analyze the bidirectional relationship between sleep disorders (particularly circadian rhythm disruption and impaired glymphatic clearan (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 007

Computational notebook for SDA-2026-04-01-gap-007

SDA
📊 Astrocyte reactivity subtypes in neurodegeneration (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 02 Gap Seaad V3 20260402063622

Computational notebook for SDA-2026-04-02-gap-seaad-v3-20260402063622

SDA
📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 001

Computational notebook for SDA-2026-04-01-gap-001

SDA
📊 TREM2 agonism vs antagonism in DAM microglia (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 02 Gap 001

Computational notebook for SDA-2026-04-02-gap-001

SDA
📊 TREM2 agonism vs antagonism in DAM microglia (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Hyp 51E7234F

Computational notebook for hyp-51e7234f

Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 011

Computational notebook for SDA-2026-04-01-gap-011

SDA
📊 Autophagy-lysosome pathway convergence across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 013

Computational notebook for SDA-2026-04-01-gap-013

SDA
📊 Senolytic therapy for age-related neurodegeneration (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: H 2600483E

Computational notebook for h-2600483e

Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 02 Gap V2 5D0E3052

Computational notebook for SDA-2026-04-02-gap-v2-5d0e3052

SDA
📊 Metabolic reprogramming in neurodegenerative disease (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 009 Statistics

Computational notebook for SDA-2026-04-01-gap-009-statistics

SDA
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 02 Gap Tau Prop 20260402003221

Computational notebook for SDA-2026-04-02-gap-tau-prop-20260402003221

SDA
📊 Tau propagation mechanisms and therapeutic interception points (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 01 Gap V2 691B42F1

Computational notebook for SDA-2026-04-01-gap-v2-691b42f1

SDA
📊 Synaptic pruning by microglia in early AD (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 20260401231108

Computational notebook for SDA-2026-04-01-gap-20260401231108

SDA
📊 Mitochondrial transfer between neurons and glia (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap V2 691B42F1

Computational notebook for SDA-2026-04-01-gap-v2-691b42f1

SDA
📊 Synaptic pruning by microglia in early AD (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Hyp 5D943Bfc

Computational notebook for hyp-5d943bfc

Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 02 Gap Ev Ad Biomarkers

Computational notebook for SDA-2026-04-02-gap-ev-ad-biomarkers

SDA
📊 Extracellular vesicle biomarkers for early AD detection (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap V2 18Cf98Ca Expression

Computational notebook for SDA-2026-04-01-gap-v2-18cf98ca-expression

SDA
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 01 Gap 011

Computational notebook for SDA-2026-04-01-gap-011

SDA
📊 Autophagy-lysosome pathway convergence across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 01 Gap 012

Computational notebook for SDA-2026-04-01-gap-012

SDA
📊 Digital biomarkers and AI-driven early detection of neurodegeneration (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: H De0D4364

Computational notebook for h-de0d4364

Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 02 Gap Aging Mouse Brain V5 20260402

Computational notebook for SDA-2026-04-02-gap-aging-mouse-brain-v5-20260402

SDA
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 02 Gap Tau Propagation 20260402

Computational notebook for SDA-2026-04-02-gap-tau-propagation-20260402

SDA
📊 Tau propagation mechanisms and therapeutic interception points (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 01 Gap 008

Computational notebook for SDA-2026-04-01-gap-008

SDA
📊 Blood-brain barrier transport mechanisms for antibody therapeutics (neurodegeneration)
Created: 2026-04-04
View Notebook →

SciDEX Analysis: 2026 04 02 Gap 20260402 003058

Computational notebook for SDA-2026-04-02-gap-20260402-003058

SDA
📊 Is disrupted sleep a cause or consequence of neurodegeneration? Analyze the bidirectional relationship between sleep disorders (particularly circadian rhythm disruption and impaired glymphatic clearan (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 01 Gap 005

Computational notebook for SDA-2026-04-01-gap-005

SDA
📊 4R-tau strain-specific spreading patterns in PSP vs CBD (neurodegeneration)
Created: 2026-04-04
View Notebook →

Top 5 Analysis: H Seaad V4 26Ba859B

Computational notebook for h-seaad-v4-26ba859b

Created: 2026-04-04
View Notebook →

Top 5 Analysis: Sda 2026 04 01 Gap Auto Fd6B1635D9

Computational notebook for SDA-2026-04-01-gap-auto-fd6b1635d9

SDA
📊 Mechanistic role of APOE in neurodegeneration (neurodegeneration)
Created: 2026-04-04
View Notebook →

ACSL4-Driven Ferroptotic Priming in Disease-Associated Microglia -- Computational Analysis

Jupyter notebook with gene expression analysis, pathway enrichment, and statistical testing for the ACSL4-Driven Ferroptotic Priming in Disease-Associated Microglia hypothesis (score: 0.82)

ACSL4 GPX4 SLC7A11 TFRC FTH1
📊 View Analysis (science)
Created: 2026-04-03

Circadian Glymphatic Entrainment via Targeted Orexin Receptor Modulation -- Computational Analysis

Jupyter notebook with gene expression analysis, pathway enrichment, and statistical testing for the Circadian Glymphatic Entrainment via Targeted Orexin Receptor Modulation hypothesis (score: 0.825)

HCRTR1 HCRTR2 AQP4 BMAL1 PER2
📊 View Analysis (science)
Created: 2026-04-03

Selective Acid Sphingomyelinase Modulation Therapy -- Computational Analysis

Jupyter notebook with gene expression analysis, pathway enrichment, and statistical testing for the Selective Acid Sphingomyelinase Modulation Therapy hypothesis (score: 0.83)

SMPD1 CERS6 SPHK1 ASAH1 GBA1
📊 View Analysis (science)
Created: 2026-04-03

Cryptic Exon Silencing Restoration -- Computational Analysis

Jupyter notebook with gene expression analysis, pathway enrichment, and statistical testing for the Cryptic Exon Silencing Restoration hypothesis (score: 0.835)

TARDBP UNC13A STMN2 FUS HNRNPA1
📊 View Analysis (science)
Created: 2026-04-03

TREM2-Dependent Microglial Senescence Transition -- Computational Analysis

Jupyter notebook with gene expression analysis, pathway enrichment, and statistical testing for the TREM2-Dependent Microglial Senescence Transition hypothesis (score: 0.85)

TREM2 TYROBP SPI1 CSF1R CX3CR1
📊 View Analysis (science)
Created: 2026-04-03

Gut microbiome dysbiosis and Parkinsons disease -- Rich Analysis Notebook

Gene expression, pathway enrichment, statistical tests for: Gut microbiome dysbiosis and Parkinsons disease

📊 What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? (neurodegeneration)
Created: 2026-04-03
View Notebook →

Perivascular spaces and glymphatic clearance failure in AD -- Rich Analysis Notebook

Gene expression, pathway enrichment, statistical tests for: Perivascular spaces and glymphatic clearance failure in AD

📊 Perivascular spaces and glymphatic clearance failure in AD (neurodegeneration)
Created: 2026-04-03
View Notebook →

Circuit-level neural dynamics in neurodegeneration -- Rich Analysis Notebook

Gene expression, pathway enrichment, statistical tests for: Circuit-level neural dynamics in neurodegeneration

📊 Circuit-level neural dynamics in neurodegeneration (neuroscience)
Created: 2026-04-03
View Notebook →

Lipid raft composition changes in synaptic neurodegeneration -- Rich Analysis Notebook

Comprehensive analysis with gene expression plots, pathway enrichment, statistical tests, and debate highlights for: Lipid raft composition changes in synaptic neurodegeneration

📊 Lipid raft composition changes in synaptic neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

Circuit-level neural dynamics — Analysis Notebook

Comprehensive analysis notebook

BDNF NTRK2 SST PVALB VIP
📊 Circuit-level neural dynamics in neurodegeneration (neuroscience)
Created: 2026-04-03
View Notebook →

Aging mouse brain — Analysis Notebook

Comprehensive analysis notebook

C4B C1QA C1QB C3 GFAP
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-03
View Notebook →

Lipid raft composition — Analysis Notebook

Comprehensive analysis notebook

CYP46A1 SMPD1 ABCA1 LDLR SREBF2
📊 Lipid raft composition changes in synaptic neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

Epigenetic reprogramming — Analysis Notebook

Comprehensive analysis notebook

SIRT1 SIRT3 HDAC3 BRD4 TET2
📊 Epigenetic reprogramming in aging neurons (neurodegeneration)
Created: 2026-04-03
View Notebook →

APOE neurodegeneration — Analysis Notebook

Comprehensive analysis notebook

APOE TREM2 ABCA1 LRP1 CLU
📊 Mechanistic role of APOE in neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

Sleep disruption — Gene Expression

Gene expression for sleep disruption

📊 Sleep disruption as cause and consequence of neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

Sleep disruption — Statistical Deep Dive

Statistical analysis for sleep disruption

📊 Sleep disruption as cause and consequence of neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

Synaptic pruning — Gene Expression

Gene expression for synaptic pruning

📊 Synaptic pruning by microglia in early AD (neurodegeneration)
Created: 2026-04-03
View Notebook →

Synaptic pruning — Statistical Deep Dive

Statistical analysis for synaptic pruning

📊 Synaptic pruning by microglia in early AD (neurodegeneration)
Created: 2026-04-03
View Notebook →

Microglia-astrocyte crosstalk — Gene Expression

Gene expression for glial crosstalk

📊 Microglia-astrocyte crosstalk amplification loops in neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

Microglia-astrocyte crosstalk — Statistical Deep Dive

Statistical analysis for glial crosstalk

📊 Microglia-astrocyte crosstalk amplification loops in neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

Autophagy-lysosome pathway — Gene Expression

Gene expression for autophagy-lysosome

📊 Autophagy-lysosome pathway convergence across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-03
View Notebook →

Autophagy-lysosome pathway — Statistical Deep Dive

Statistical analysis for autophagy-lysosome

📊 Autophagy-lysosome pathway convergence across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-03
View Notebook →

TDP-43 phase separation — Statistical Deep Dive

Statistical analysis for phase separation

📊 TDP-43 phase separation therapeutics for ALS-FTD (neurodegeneration)
Created: 2026-04-03
View Notebook →

TDP-43 phase separation — Gene Expression

Gene expression analysis

TARDBP FUS HNRNPA1
📊 TDP-43 phase separation therapeutics for ALS-FTD (neurodegeneration)
Created: 2026-04-03
View Notebook →

Cell type vulnerability in Alzheimer's Disease (SEA-AD data - v2) - Rich Analysis Notebook

Rich analysis notebook with gene expression, pathway enrichment, radar scoring, and statistical tests for Cell type vulnerability in Alzheimer's Disease (SEA-AD data - v2).

📊 Cell type vulnerability in Alzheimer's Disease (SEA-AD data - v2) (neurodegeneration)
Created: 2026-04-03
View Notebook →

CYP46A1 Overexpression Gene Therapy -- Computational Analysis

Rich computational analysis notebook for hypothesis h-2600483e with gene expression, pathway enrichment, score radar, and statistical analysis.

CYP46A1 BACE1 APP APOE ABCA1
Created: 2026-04-03

Nutrient-Sensing Epigenetic Circuit Reactivation -- Computational Analysis

Rich computational analysis notebook for hypothesis h-4bb7fd8c with gene expression, pathway enrichment, score radar, and statistical analysis.

SIRT1 NAMPT PGC1A AMPK FOXO3
Created: 2026-04-03

TREM2 agonism vs antagonism in DAM microglia - Rich Analysis

TREM2/DAM analysis with expression plots, pathway enrichment, hypothesis scoring

📊 TREM2 agonism vs antagonism in DAM microglia (neurodegeneration)
Created: 2026-04-03
View Notebook →

Lipid raft composition changes in synaptic neurodegeneration - Rich Analysis

Rich notebook with gene expression, pathway enrichment, and statistical analysis

SMPD1 ABCA1/LDLR/SREBF2 CYP46A1 ST3GAL2/ST8SIA1 SGMS1/SGMS2
📊 Lipid raft composition changes in synaptic neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

Perivascular spaces and glymphatic clearance failure in AD - Rich Analysis

Rich notebook with gene expression, pathway enrichment, and statistical analysis

HCRTR1/HCRTR2 SDC1 LOX/LOXL1-4 GJA1 PDGFRB
📊 Perivascular spaces and glymphatic clearance failure in AD (neurodegeneration)
Created: 2026-04-03
View Notebook →

Mechanistic role of APOE in neurodegeneration - Rich Analysis

Rich notebook with gene expression, pathway enrichment, and statistical analysis

MTOR HSPA1A TREM2 APOE SPTLC1
📊 Mechanistic role of APOE in neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? - Rich Analysis

Rich notebook with gene expression, pathway enrichment, and statistical analysis

GPR109A TLR4 CHRNA7 CSGA TDC
📊 What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? (neurodegeneration)
Created: 2026-04-03
View Notebook →

RNA binding protein dysregulation across ALS FTD and AD - Rich Analysis

Rich notebook

TARDBP G3BP1 HNRNPA2B1 SETX SYNCRIP
📊 RNA binding protein dysregulation across ALS FTD and AD (neurodegeneration)
Created: 2026-04-03
View Notebook →

TDP-43 phase separation therapeutics for ALS-FTD — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. What are the mechanisms underlying tdp-43 phase separation therapeutics for als-ftd?

📊 TDP-43 phase separation therapeutics for ALS-FTD (neurodegeneration)
Created: 2026-04-03
View Notebook →

Sleep disruption as cause and consequence of neurodegeneration — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. What are the mechanisms underlying sleep disruption as cause and consequence of neurodegeneration?

📊 Sleep disruption as cause and consequence of neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

Synaptic pruning by microglia in early AD — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. What are the mechanisms underlying synaptic pruning by microglia in early ad?

📊 Synaptic pruning by microglia in early AD (neurodegeneration)
Created: 2026-04-03
View Notebook →

Autophagy-lysosome pathway convergence across neurodegenerative diseases — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. What are the mechanisms underlying autophagy-lysosome pathway convergence across neurodegenerative

📊 Autophagy-lysosome pathway convergence across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-03
View Notebook →

Mechanistic role of APOE in neurodegeneration — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. What are the mechanisms underlying mechanistic role of apoe in neurodegeneration?

📊 Mechanistic role of APOE in neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability - Top 5 Rich Notebook

Rich notebook with gene expression, pathway enrichment, KG network, score heatmaps, and statistical analysis.

📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-03
View Notebook →

Lipid raft composition changes in synaptic neurodegeneration - Top 5 Rich Notebook

Rich notebook with gene expression, pathway enrichment, KG network, score heatmaps, and statistical analysis.

📊 Lipid raft composition changes in synaptic neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) - Top 5 Rich Notebook

Rich notebook with gene expression, pathway enrichment, KG network, score heatmaps, and statistical analysis.

📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-03
View Notebook →

Circuit-level neural dynamics in neurodegeneration - Top 5 Rich Notebook

Rich notebook with gene expression, pathway enrichment, KG network, score heatmaps, and statistical analysis.

📊 Circuit-level neural dynamics in neurodegeneration (neuroscience)
Created: 2026-04-03
View Notebook →

Microglia-astrocyte crosstalk amplification loops in neurodegeneration — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. What are the mechanisms underlying microglia-astrocyte crosstalk amplification loops in neurodegen

📊 Microglia-astrocyte crosstalk amplification loops in neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. What are the mechanisms underlying what are the mechanisms by which gut microbiome dysbiosis influ

📊 What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? (neurodegeneration)
Created: 2026-04-03
View Notebook →

Perivascular spaces and glymphatic clearance failure in AD — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. What are the mechanisms underlying perivascular spaces and glymphatic clearance failure in ad?

📊 Perivascular spaces and glymphatic clearance failure in AD (neurodegeneration)
Created: 2026-04-03
View Notebook →

Lipid raft composition changes in synaptic neurodegeneration — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. Investigate how lipid raft composition (cholesterol metabolism, sphingolipids) changes in synaptic

📊 Lipid raft composition changes in synaptic neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

RNA binding protein dysregulation across ALS FTD and AD — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. What are the mechanisms underlying rna binding protein dysregulation across als ftd and ad?

📊 RNA binding protein dysregulation across ALS FTD and AD (neurodegeneration)
Created: 2026-04-03
View Notebook →

Tau propagation mechanisms and therapeutic interception points — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-02-gap-tau-prop-20260402003221: Investigate prion-like spreading of tau pathology through connected brain regions, focusing on trans-synaptic transfer, extrac

📊 Tau propagation mechanisms and therapeutic interception points (neurodegeneration)
Created: 2026-04-03
View Notebook →

Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-02-gap-aging-mouse-brain-20260402: What gene expression changes in the aging mouse brain predict neurodegenerative vulnerability? Use Allen Aging Mouse Brain

📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-03
View Notebook →

Circuit-level neural dynamics in neurodegeneration — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-02-26abc5e5f9f2: Analyze circuit-level changes in neurodegeneration using Allen Institute Neural Dynamics data. Focus on: (1) hippocampal circuit disruption,

📊 Circuit-level neural dynamics in neurodegeneration (neuroscience)
Created: 2026-04-03
View Notebook →

Extracellular vesicle biomarkers for early AD detection — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-02-gap-ev-ad-biomarkers: Extracellular vesicles (EVs), including exosomes and microvesicles, carry molecular cargo (proteins, miRNAs, lipids) from their cells

📊 Extracellular vesicle biomarkers for early AD detection (neurodegeneration)
Created: 2026-04-03
View Notebook →

CRISPR-based therapeutic approaches for neurodegenerative diseases — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-02-gap-crispr-neurodegeneration-20260402: Evaluate the potential of CRISPR/Cas9 and related gene editing technologies for treating neurodegenerative diseases

📊 CRISPR-based therapeutic approaches for neurodegenerative diseases (neurodegeneration)
Created: 2026-04-03
View Notebook →

Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-02-gap-seaad-v3-20260402063622: What cell types are most vulnerable in Alzheimers Disease based on SEA-AD transcriptomic data from the Allen Brain Cell Atlas?

📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-03
View Notebook →

Senescent cell clearance as neurodegeneration therapy — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-02-gap-senescent-clearance-neuro: Senescent cell clearance as neurodegeneration therapy

📊 Senescent cell clearance as neurodegeneration therapy (neurodegeneration)
Created: 2026-04-03
View Notebook →

Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-02-gap-seaad-v4-20260402065846: What cell types are most vulnerable in Alzheimers Disease based on SEA-AD transcriptomic data from the Allen Brain Cell Atlas?

📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-03
View Notebook →

Epigenetic reprogramming in aging neurons — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-02-gap-epigenetic-reprog-b685190e: Investigate mechanisms of epigenetic reprogramming in aging neurons...

📊 Epigenetic reprogramming in aging neurons (neurodegeneration)
Created: 2026-04-03
View Notebook →

Selective vulnerability of entorhinal cortex layer II neurons in AD — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-01-gap-004: What are the mechanisms underlying selective vulnerability of entorhinal cortex layer ii neurons in ad?

📊 Selective vulnerability of entorhinal cortex layer II neurons in AD (neurodegeneration)
Created: 2026-04-03
View Notebook →

4R-tau strain-specific spreading patterns in PSP vs CBD — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-01-gap-005: What are the mechanisms underlying 4r-tau strain-specific spreading patterns in psp vs cbd?

📊 4R-tau strain-specific spreading patterns in PSP vs CBD (neurodegeneration)
Created: 2026-04-03
View Notebook →

Astrocyte reactivity subtypes in neurodegeneration — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-01-gap-007: What are the mechanisms underlying astrocyte reactivity subtypes in neurodegeneration?

📊 Astrocyte reactivity subtypes in neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

Blood-brain barrier transport mechanisms for antibody therapeutics — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-01-gap-008: What are the mechanisms underlying blood-brain barrier transport mechanisms for antibody therapeutics?

📊 Blood-brain barrier transport mechanisms for antibody therapeutics (neurodegeneration)
Created: 2026-04-03
View Notebook →

APOE4 structural biology and therapeutic targeting strategies — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-01-gap-010: What are the mechanisms underlying apoe4 structural biology and therapeutic targeting strategies?

📊 APOE4 structural biology and therapeutic targeting strategies (neurodegeneration)
Created: 2026-04-03
View Notebook →

Digital biomarkers and AI-driven early detection of neurodegeneration — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-01-gap-012: What are the mechanisms underlying digital biomarkers and ai-driven early detection of neurodegeneration?

📊 Digital biomarkers and AI-driven early detection of neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

Senolytic therapy for age-related neurodegeneration — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-01-gap-013: What are the mechanisms underlying senolytic therapy for age-related neurodegeneration?

📊 Senolytic therapy for age-related neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

Neuroinflammation resolution mechanisms and pro-resolving mediators — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-01-gap-014: What are the mechanisms underlying neuroinflammation resolution mechanisms and pro-resolving mediators?

📊 Neuroinflammation resolution mechanisms and pro-resolving mediators (neurodegeneration)
Created: 2026-04-03
View Notebook →

What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-01-gap-20260401-225149: What are the mechanisms underlying what are the mechanisms by which gut microbiome dysbiosis influences parkinson's disease pathogenes

showcase forge-tools walkthrough
📊 What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? (neurodegeneration)
Created: 2026-04-03
View Notebook →

Mitochondrial transfer between neurons and glia — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-01-gap-20260401231108: What are the mechanisms underlying mitochondrial transfer between neurons and glia?

📊 Mitochondrial transfer between neurons and glia (neurodegeneration)
Created: 2026-04-03
View Notebook →

Protein aggregation cross-seeding across neurodegenerative diseases — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-01-gap-9137255b: What are the mechanisms underlying protein aggregation cross-seeding across neurodegenerative diseases?

📊 Protein aggregation cross-seeding across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-03
View Notebook →

Mitochondrial transfer between astrocytes and neurons — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-01-gap-v2-89432b95: What are the mechanisms underlying mitochondrial transfer between astrocytes and neurons?

📊 Mitochondrial transfer between astrocytes and neurons (neurodegeneration)
Created: 2026-04-03
View Notebook →

Epigenetic clocks and biological aging in neurodegeneration — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-01-gap-v2-bc5f270e: What are the mechanisms underlying epigenetic clocks and biological aging in neurodegeneration?

📊 Epigenetic clocks and biological aging in neurodegeneration (neurodegeneration)
Created: 2026-04-03
View Notebook →

Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) — Rich Analysis Notebook

No description

📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-03
View Notebook →

Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) — Rich Analysis Notebook

No description

📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-03
View Notebook →

Senescent cell clearance as neurodegeneration therapy — Rich Analysis Notebook

No description

📊 Senescent cell clearance as neurodegeneration therapy (neurodegeneration)
Created: 2026-04-03
View Notebook →

Epigenetic reprogramming in aging neurons — Rich Analysis Notebook

No description

📊 Epigenetic reprogramming in aging neurons (neurodegeneration)
Created: 2026-04-03
View Notebook →

Senolytic therapy for age-related neurodegeneration — Executed Analysis Notebook

Rich Jupyter notebook with gene expression heatmap, volcano plot, pathway enrichment, statistical tests, and hypothesis radar chart.

C1Q/C3 CD38/NAMPT AQP4 MMP2/MMP9 GPX4/SLC7A11
📊 Senolytic therapy for age-related neurodegeneration (neurodegeneration)
Created: 2026-04-02
View Notebook →

APOE4 structural biology and therapeutic targeting strategies — Executed Analysis Notebook

Rich Jupyter notebook with gene expression heatmap, volcano plot, pathway enrichment, statistical tests, and hypothesis radar chart.

HSPA1A, HSP90AA1, DNAJB1, FKBP5 APOE APOE APOE APOE
📊 APOE4 structural biology and therapeutic targeting strategies (neurodegeneration)
Created: 2026-04-02
View Notebook →

4R-tau strain-specific spreading patterns in PSP vs CBD — Executed Analysis Notebook

Rich Jupyter notebook with gene expression heatmap, volcano plot, pathway enrichment, statistical tests, and hypothesis radar chart.

P2RY12 CERS2 HSPG2 EPHB4 AQP4
📊 4R-tau strain-specific spreading patterns in PSP vs CBD (neurodegeneration)
Created: 2026-04-02
View Notebook →

Selective vulnerability of entorhinal cortex layer II neurons in AD — Executed Analysis Notebook

Rich Jupyter notebook with gene expression heatmap, volcano plot, pathway enrichment, statistical tests, and hypothesis radar chart.

MAP6 PPARGC1A RELN HCN1 SLC16A2
📊 Selective vulnerability of entorhinal cortex layer II neurons in AD (neurodegeneration)
Created: 2026-04-02
View Notebook →

Metabolic reprogramming in neurodegenerative disease — Executed Analysis Notebook

Rich Jupyter notebook with gene expression heatmap, volcano plot, pathway enrichment, statistical tests, and hypothesis radar chart.

TFEB GLUT3/GLUT4 HMGCS2
📊 Metabolic reprogramming in neurodegenerative disease (neurodegeneration)
Created: 2026-04-02
View Notebook →

Circuit-level neural dynamics in neurodegeneration — Executed Analysis Notebook

Rich Jupyter notebook with gene expression heatmap, volcano plot, pathway enrichment, statistical tests, and hypothesis radar chart for Circuit-level neural dynamics in neurodegeneration.

BDNF SST PVALB
📊 Circuit-level neural dynamics in neurodegeneration (neuroscience)
Created: 2026-04-02
View Notebook →

Tau propagation mechanisms and therapeutic interception points — Executed Analysis Notebook

Rich Jupyter notebook with gene expression heatmap, volcano plot, pathway enrichment, statistical tests, and hypothesis radar chart for Tau propagation mechanisms and therapeutic interception points.

HSP90AA1 TREM2 VCP LRP1 CHMP4B
📊 Tau propagation mechanisms and therapeutic interception points (neurodegeneration)
Created: 2026-04-02
View Notebook →

Epigenetic reprogramming in aging neurons — Executed Analysis Notebook

Rich Jupyter notebook with gene expression heatmap, volcano plot, pathway enrichment, statistical tests, and hypothesis radar chart for Epigenetic reprogramming in aging neurons.

SIRT1 HDAC3 BRD4 HDAC SIRT3
📊 Epigenetic reprogramming in aging neurons (neurodegeneration)
Created: 2026-04-02
View Notebook →

Aging Mouse Brain Atlas: Cross-Age Gene Expression Analysis

Differential expression analysis across hippocampus, cortex, and cerebellum in young, middle-aged, and old mice. Identifies aging-neurodegeneration overlap with 5 testable hypotheses.

Aging Mouse Model Gene Expression Neurodegeneration Cross-Age Analysis
APOE TREM2 GFAP SYP TFAM
Created: 2026-04-02

SEA-AD Gene Expression Analysis: Microglia vs Neurons

Differential gene expression analysis of Alzheimer's disease-related genes comparing microglia and neurons using Seattle Alzheimer's Disease Brain Cell Atlas (SEA-AD) data. Includes heatmap, volcano p

SEA-AD Allen Institute Alzheimer's Gene Expression Microglia
APP APOE MAPT TREM2 CD33
Created: 2026-04-02
View Notebook →

Is disrupted sleep a cause or consequence of neurodegeneration? Analyze the bidirectional relationship between sleep disorders (particularly circadian rhythm disruption and impaired glymphatic clearan

Analysis ID: SDA-2026-04-02-gap-20260402-003058 Domain: neurodegeneration Hypotheses: 0 KG Edges: 0+

neurodegeneration
📊 Is disrupted sleep a cause or consequence of neurodegeneration? Analyze the bidirectional relationship between sleep disorders (particularly circadian rhythm disruption and impaired glymphatic clearan (neurodegeneration)
Created: 2026-04-02

Is disrupted sleep a cause or consequence of neurodegeneration? Analyze the bidirectional relationship between sleep disorders (particularly circadian rhythm disruption and impaired glymphatic clearan

Analysis ID: SDA-2026-04-02-gap-20260402-003115 Domain: neurodegeneration Hypotheses: 0 KG Edges: 0+

neurodegeneration
📊 Is disrupted sleep a cause or consequence of neurodegeneration? Analyze the bidirectional relationship between sleep disorders (particularly circadian rhythm disruption and impaired glymphatic clearan (neurodegeneration)
Created: 2026-04-02

Epigenetic reprogramming in aging neurons

SciDEX Analysis | ID: SDA-2026-04-02-gap-epigenetic-reprog-b685190e

epigenetics neurodegeneration statistics
Created: 2026-04-02

Immune Atlas: Neuroinflammation in Neurodegeneration

Analysis ID: SDA-2026-04-02-gap-immune-atlas-neuroinflam-20260402 Date: 2026-04-02 Domain: Neuroinflammation

gene-expression microglia neurodegeneration neuroinflammation statistics
📊 Immune atlas neuroinflammation analysis in neurodegeneration (Neuroinflammation)
Created: 2026-04-02
View Notebook →

Microglial Subtypes in Neurodegeneration: Friend vs Foe

Analysis ID: SDA-2026-04-02-gap-microglial-subtypes-20260402004119 Date: 2026-04-02 Domain: Neurodegeneration -- Neuroimmunology

microglia neurodegeneration statistics
📊 Microglial subtypes in neurodegeneration — friend vs foe (neuroscience)
Created: 2026-04-02
View Notebook →

Cell-Type Vulnerability in Alzheimer's Disease — SEA-AD Transcriptomics (v3)

What cell types are most vulnerable in Alzheimer's Disease based on SEA-AD transcriptomic data? Identify differential gene expression, vulnerability scores, and regulatory networks in excitatory neuro

SEA-AD gene-expression microglia neurodegeneration statistics
📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-02
View Notebook →

Cell-Type Vulnerability in Alzheimer's Disease — SEA-AD Transcriptomics (v4)

Extended SEA-AD analysis: identify cell-type-specific gene regulatory networks that predict vulnerability. Focus on super-enhancer-linked genes, TF binding, and cross-cell-type communication in AD-aff

SEA-AD gene-expression microglia neurodegeneration statistics
📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-02
View Notebook →

Tau propagation mechanisms and therapeutic interception points

Analysis ID: SDA-2026-04-02-gap-tau-prop-20260402003221

gene-expression microglia neurodegeneration statistics tau
📊 Tau propagation mechanisms and therapeutic interception points (neurodegeneration)
Created: 2026-04-02
View Notebook →

Tau Propagation Mechanisms and Therapeutic Interception Points

Analysis ID: SDA-2026-04-02-gap-tau-propagation-20260402 Date: 2026-04-02 Domain: Neurodegeneration -- Tauopathies

neurodegeneration statistics tau
📊 Tau propagation mechanisms and therapeutic interception points (neurodegeneration)
Created: 2026-04-02
View Notebook →

Circuit-level neural dynamics in neurodegeneration

Analyze circuit-level changes in neurodegeneration using Allen Institute Neural Dynamics data. Focus on: (1) hippocampal circuit disruption, (2) cortical dynamics alterations, (3) sensory processing c

gene-expression hypothesis-analysis neurodegeneration statistics
📊 Circuit-level neural dynamics in neurodegeneration (neuroscience)
Created: 2026-04-02
View Notebook →

Gene Expression in Aging Mouse Brain Predicting Neurodegeneration (v1)

What gene expression changes in the aging mouse brain predict neurodegenerative vulnerability? Using Allen Brain Atlas aging datasets, identify conserved transcriptomic signatures across 3, 12, 18, an

aging gene-expression hypothesis-analysis neurodegeneration statistics
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-02
View Notebook →

Cellular Senescence Signatures in Aging Mouse Brain (v5)

Which cellular senescence markers in aging mouse brain best predict downstream neurodegeneration risk? Focus on p21/p16 axis, SASP factors, and their interaction with neuroinflammatory cascades.

aging gene-expression hypothesis-analysis microglia neurodegeneration
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-02
View Notebook →

CRISPR-Based Therapeutic Approaches for Neurodegenerative Diseases

Analysis ID: SDA-2026-04-02-gap-crispr-neurodegeneration-20260402 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 5 Knowledge Graph Edges: 15

CRISPR SEA-AD epigenetics gene-expression hypothesis-analysis
📊 CRISPR-based therapeutic approaches for neurodegenerative diseases (neurodegeneration)
Created: 2026-04-02
View Notebook →

Epigenetic Reprogramming in Aging Neurons — Mechanistic Analysis

Investigate mechanisms of epigenetic reprogramming in aging neurons. How do changes in DNA methylation, histone modification, and chromatin remodeling contribute to neurodegeneration risk?

SEA-AD epigenetics gene-expression hypothesis-analysis microglia
📊 Epigenetic reprogramming in aging neurons (neurodegeneration)
Created: 2026-04-02
View Notebook →

Extracellular Vesicle Biomarkers for Early Alzheimer's Disease Detection

Which extracellular vesicle (EV) cargo proteins best discriminate early AD from controls? Characterize EV proteome from plasma, CSF, and brain tissue across disease stages using multi-cohort data.

SEA-AD biomarkers gene-expression hypothesis-analysis microglia
📊 Extracellular vesicle biomarkers for early AD detection (neurodegeneration)
Created: 2026-04-02
View Notebook →

SEA-AD v4: Inhibitory Neuron Subtypes and Circuit Vulnerability in AD

Which inhibitory neuron subtypes show earliest transcriptomic divergence in AD? Characterize Sst, Pvalb, and Vip+ interneuron vulnerability and link to circuit dysfunction biomarkers.

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-02
View Notebook →

Senescent Cell Clearance as Neurodegeneration Therapy

Analysis ID: SDA-2026-04-02-gap-senescent-clearance-neuro Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 5 Knowledge Graph Edges: 15

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Senescent cell clearance as neurodegeneration therapy (neurodegeneration)
Created: 2026-04-02
View Notebook →

Tau propagation mechanisms and therapeutic interception points

Analysis ID: SDA-2026-04-02-gap-tau-prop-20260402003221 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 77

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Tau propagation mechanisms and therapeutic interception points (neurodegeneration)
Created: 2026-04-02
View Notebook →

Metabolic reprogramming in neurodegenerative disease

Analysis ID: SDA-2026-04-02-gap-v2-5d0e3052 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 3 Knowledge Graph Edges: 31

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Metabolic reprogramming in neurodegenerative disease (neurodegeneration)
Created: 2026-04-02
View Notebook →

SEA-AD Gene Expression Profiling — Allen Brain Cell Atlas

Analysis ID: analysis-SEAAD-20260402 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 5 Knowledge Graph Edges: 63

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 SEA-AD Gene Expression Profiling — Allen Brain Cell Atlas (neurodegeneration)
Created: 2026-04-02
View Notebook →

Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) - Rich Analysis Notebook

Enhanced notebook with gene expression, pathway enrichment, and statistical analysis for: What cell types are most vulnerable in Alzheimers Disease based on SEA-AD transcriptomic data from t

📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-02
View Notebook →

Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability - Rich Analysis Notebook

Enhanced notebook with gene expression, pathway enrichment, and statistical analysis for: What gene expression changes in the aging mouse brain predict neurodegenerative vulnerability? Use A

📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-02
View Notebook →

Protein aggregation cross-seeding across neurodegenerative diseases — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. What are the mechanisms underlying protein aggregation cross-seeding across neurodegenerative dise

📊 Protein aggregation cross-seeding across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-02
View Notebook →

SEA-AD Gene Expression Profiling — Allen Brain Cell Atlas — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. What are the cell-type specific expression patterns of key neurodegeneration genes in the Seattle

📊 SEA-AD Gene Expression Profiling — Allen Brain Cell Atlas (neurodegeneration)
Created: 2026-04-02
View Notebook →

What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. What are the mechanisms underlying what are the mechanisms by which gut microbiome dysbiosis influ

showcase forge-tools walkthrough
📊 What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? (neurodegeneration)
Created: 2026-04-02
View Notebook →

Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. What cell types are most vulnerable in Alzheimers Disease based on SEA-AD transcriptomic data from

📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-02
View Notebook →

Mitochondrial transfer between neurons and glia — Rich Analysis Notebook

Comprehensive analysis with gene expression, pathway enrichment, and statistical tests for Mitochondrial transfer between neurons and glia

📊 Mitochondrial transfer between neurons and glia (neurodegeneration)
Created: 2026-04-02
View Notebook →

Digital biomarkers and AI-driven early detection of neurodegeneration — Rich Analysis Notebook

Comprehensive analysis with gene expression, pathway enrichment, and statistical tests for Digital biomarkers and AI-driven early detection of neurodegeneration

📊 Digital biomarkers and AI-driven early detection of neurodegeneration (neurodegeneration)
Created: 2026-04-02
View Notebook →

Blood-brain barrier transport mechanisms for antibody therapeutics — Rich Analysis Notebook

Comprehensive analysis with gene expression, pathway enrichment, and statistical tests for Blood-brain barrier transport mechanisms for antibody therapeutics

📊 Blood-brain barrier transport mechanisms for antibody therapeutics (neurodegeneration)
Created: 2026-04-02
View Notebook →

Astrocyte reactivity subtypes in neurodegeneration — Rich Analysis Notebook

Comprehensive analysis with gene expression, pathway enrichment, and statistical tests for Astrocyte reactivity subtypes in neurodegeneration

📊 Astrocyte reactivity subtypes in neurodegeneration (neurodegeneration)
Created: 2026-04-02
View Notebook →

Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability — Rich Analysis Notebook

Enhanced notebook with gene expression, pathway enrichment, and statistical analysis for: What gene expression changes in the aging mouse brain predict neurodegenerative vulnerability? Use A

📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-02
View Notebook →

Circuit-level neural dynamics in neurodegeneration — Rich Analysis Notebook

Enhanced notebook with gene expression, pathway enrichment, and statistical analysis for: Analyze circuit-level changes in neurodegeneration using Allen Institute Neural Dynamics data. Focus

📊 Circuit-level neural dynamics in neurodegeneration (neuroscience)
Created: 2026-04-02
View Notebook →

Circuit-level neural dynamics in neurodegeneration - Rich Analysis Notebook

Enhanced notebook with gene expression, pathway enrichment, and statistical analysis for: Analyze circuit-level changes in neurodegeneration using Allen Institute Neural Dynamics data. Focus

📊 Circuit-level neural dynamics in neurodegeneration (neuroscience)
Created: 2026-04-02
View Notebook →

CRISPR-Based Therapeutic Approaches for Neurodegenerative Diseases

What is the potential of CRISPR/Cas9 and related gene editing technologies for treating neurodegenerative diseases?

📊 CRISPR-based therapeutic approaches for neurodegenerative diseases (neurodegeneration)
Created: 2026-04-02
View Notebook →

Neuroinflammation Resolution Mechanisms and Pro-Resolving Mediators

How do specialized pro-resolving mediators (SPMs) resolve neuroinflammation, and can their pathways be therapeutically enhanced?

📊 Neuroinflammation resolution mechanisms and pro-resolving mediators (neurodegeneration)
Created: 2026-04-02
View Notebook →

APOE4 Structural Biology and Therapeutic Targeting Strategies

What are the structural mechanisms underlying APOE4 pathogenicity and how can they be exploited for therapeutic intervention?

📊 APOE4 structural biology and therapeutic targeting strategies (neurodegeneration)
Created: 2026-04-02
View Notebook →

CRISPR-based Therapeutic Approaches for Neurodegenerative Diseases — Rich Analysis Notebook

Rich notebook with plots and analysis.

📊 CRISPR-based therapeutic approaches for neurodegenerative diseases (neurodegeneration)
Created: 2026-04-02
View Notebook →

Senescent Cell Clearance as Neurodegeneration Therapy — Rich Analysis Notebook

Rich notebook with plots and analysis.

📊 Senescent cell clearance as neurodegeneration therapy (neurodegeneration)
Created: 2026-04-02
View Notebook →

Cell Type Vulnerability in Alzheimer's Disease (SEA-AD v3) — Rich Analysis Notebook

Rich notebook with plots and analysis.

📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-02
View Notebook →

Epigenetic reprogramming in aging neurons — Rich Analysis Notebook

Rich notebook with gene expression, pathway enrichment, radar scoring, statistical tests.

📊 Epigenetic reprogramming in aging neurons (neurodegeneration)
Created: 2026-04-02
View Notebook →

Selective vulnerability of entorhinal cortex layer II neurons in AD — Rich Analysis Notebook

Rich notebook with gene expression, pathway enrichment, radar scoring, statistical tests.

📊 Selective vulnerability of entorhinal cortex layer II neurons in AD (neurodegeneration)
Created: 2026-04-02
View Notebook →

4R-tau strain-specific spreading patterns in PSP vs CBD — Rich Analysis Notebook

Rich notebook with gene expression, pathway enrichment, radar scoring, statistical tests.

📊 4R-tau strain-specific spreading patterns in PSP vs CBD (neurodegeneration)
Created: 2026-04-02
View Notebook →

Selective Vulnerability of Entorhinal Cortex Layer II Neurons — Multi-Target Analysis

Rich data analysis notebook for: Selective vulnerability of entorhinal cortex layer II neurons in AD. What are the mechanisms underlying selective vulnerability of entorhinal cortex layer ii neurons i

📊 Selective vulnerability of entorhinal cortex layer II neurons in AD (neurodegeneration)
Created: 2026-04-02
View Notebook →

4R-Tau Strain-Specific Spreading Patterns in PSP vs CBD — Comparative Analysis

Rich data analysis notebook for: 4R-tau strain-specific spreading patterns in PSP vs CBD. What are the mechanisms underlying 4r-tau strain-specific spreading patterns in psp vs cbd?

📊 4R-tau strain-specific spreading patterns in PSP vs CBD (neurodegeneration)
Created: 2026-04-02
View Notebook →

Circuit-Level Neural Dynamics — Hippocampal and Cortical Circuits

Analysis of 20 circuit-related genes across CA3/CA1 pyramidal neurons and SST/PV/VIP interneurons. Examines BDNF-NTRK2 signaling, interneuron markers, NMDA receptors, and synaptic gene modules.

BDNF SST PVALB CAMK2A GRIN1
📊 Circuit-level neural dynamics in neurodegeneration (neuroscience)
Created: 2026-04-02
View Notebook →

Senolytic Therapy — SASP, Complement, and NAD+ Mechanisms

Expression analysis of 20 senescence/SASP genes across Senescent Glia, Healthy Glia, Neurons, and Endothelial cells. Validates complement cascade (C1Q/C3), CD38-NAD+ depletion, AQP4 dysregulation, and

C1QA C3 CD38 NAMPT AQP4
📊 Senolytic therapy for age-related neurodegeneration (neurodegeneration)
Created: 2026-04-02
View Notebook →

Astrocyte reactivity subtypes in neurodegeneration — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. What are the mechanisms underlying astrocyte reactivity subtypes in neurodegeneration?

📊 Astrocyte reactivity subtypes in neurodegeneration (neurodegeneration)
Created: 2026-04-02
View Notebook →

Blood-brain barrier transport mechanisms for antibody therapeutics — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. What are the mechanisms underlying blood-brain barrier transport mechanisms for antibody therapeut

📊 Blood-brain barrier transport mechanisms for antibody therapeutics (neurodegeneration)
Created: 2026-04-02
View Notebook →

Digital biomarkers and AI-driven early detection of neurodegeneration — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. What are the mechanisms underlying digital biomarkers and ai-driven early detection of neurodegene

📊 Digital biomarkers and AI-driven early detection of neurodegeneration (neurodegeneration)
Created: 2026-04-02
View Notebook →

Senolytic therapy for age-related neurodegeneration — Rich Analysis

Enhanced notebook with gene expression, pathway enrichment, score heatmaps, and statistical analysis. What are the mechanisms underlying senolytic therapy for age-related neurodegeneration?

📊 Senolytic therapy for age-related neurodegeneration (neurodegeneration)
Created: 2026-04-02
View Notebook →

Mitochondrial transfer between neurons and glia — Analysis Notebook

Jupyter notebook for analysis SDA-2026-04-01-gap-20260401231108: What are the mechanisms underlying mitochondrial transfer between neurons and glia?

📊 Mitochondrial transfer between neurons and glia (neurodegeneration)
Created: 2026-04-02
View Notebook →

Rich Analysis: Senescent Cell Clearance as Neurodegeneration Therapy

Comprehensive notebook with gene expression, pathway enrichment, and statistical analysis for Senescent Cell Clearance as Neurodegeneration Therapy

📊 Senescent cell clearance as neurodegeneration therapy (neurodegeneration)
Created: 2026-04-02
View Notebook →

Rich Analysis: Cell Type Vulnerability in Alzheimer's Disease — SEA-AD v3

Comprehensive notebook with gene expression, pathway enrichment, and statistical analysis for Cell Type Vulnerability in Alzheimer's Disease — SEA-AD v3

📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-02
View Notebook →

Rich Analysis: Extracellular Vesicle Biomarkers for Early AD Detection

Comprehensive notebook with gene expression, pathway enrichment, and statistical analysis for Extracellular Vesicle Biomarkers for Early AD Detection

📊 Extracellular vesicle biomarkers for early AD detection (neurodegeneration)
Created: 2026-04-02
View Notebook →

Tau propagation mechanisms and therapeutic interception points - Rich Analysis Notebook

Rich analysis notebook with gene expression, pathway enrichment, radar scoring, and statistical tests for Tau propagation mechanisms and therapeutic interception points.

📊 Tau propagation mechanisms and therapeutic interception points (neurodegeneration)
Created: 2026-04-02
View Notebook →

Aging Mouse Brain — Complement Cascade Notebook

Gene expression analysis of complement cascade in aging mouse brain.

📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-02
View Notebook →

Notebook: Cell type vulnerability in Alzheimer's Disease (SEA-AD data - v2)

Auto-generated analysis notebook for SDA-2026-04-02-gap-seaad-v2-20260402032945

📊 Cell type vulnerability in Alzheimer's Disease (SEA-AD data - v2) (neurodegeneration)
Created: 2026-04-02
View Notebook →

Epigenetic reprogramming in aging neurons - Rich Analysis Notebook

Executed notebook with gene expression plots, pathway enrichment, radar charts, and statistical tests for: Investigate mechanisms of epigenetic reprogramming in aging neurons...

📊 Epigenetic reprogramming in aging neurons (neurodegeneration)
Created: 2026-04-02
View Notebook →

Circuit-level neural dynamics in neurodegeneration - Rich Analysis Notebook

Executed notebook with gene expression plots, pathway enrichment, radar charts, and statistical tests for: Analyze circuit-level changes in neurodegeneration using Allen Institute Neural Dynamics data

📊 Circuit-level neural dynamics in neurodegeneration (neuroscience)
Created: 2026-04-02
View Notebook →

Circuit-level neural dynamics in neurodegeneration - Rich Analysis Notebook

Executed notebook with gene expression plots, pathway enrichment, radar charts, and statistical tests for: Analyze circuit-level changes in neurodegeneration using Allen Institute Neural Dynamics data

📊 Circuit-level neural dynamics in neurodegeneration (neuroscience)
Created: 2026-04-02
View Notebook →

Epigenetic clocks and biological aging in neurodegeneration - Rich Analysis Notebook

Enhanced notebook with gene expression, pathway enrichment, and statistical analysis for: What are the mechanisms underlying epigenetic clocks and biological aging in neurodegeneration?

📊 Epigenetic clocks and biological aging in neurodegeneration (neurodegeneration)
Created: 2026-04-02
View Notebook →

Extracellular vesicle biomarkers for early AD detection

Rich Jupyter notebook for Extracellular vesicle biomarkers for early AD detection

📊 Extracellular vesicle biomarkers for early AD detection (neurodegeneration)
Created: 2026-04-02
View Notebook →

Immune atlas neuroinflammation in neurodegeneration - Rich Analysis Notebook

Comprehensive analysis of microglial subtypes (DAM, homeostatic, inflammatory) across AD, PD, ALS. Includes PCA, pathway heatmaps, T-cell infiltration statistics.

📊 Immune atlas neuroinflammation analysis in neurodegeneration (Neuroinflammation)
Created: 2026-04-02
View Notebook →

Tau propagation mechanisms and therapeutic interception - Rich Analysis Notebook

Network diffusion model of tau spread through brain regions. Braak staging simulation, intervention modeling, EV-mediated transfer analysis.

📊 Tau propagation mechanisms and therapeutic interception points (neurodegeneration)
Created: 2026-04-02
View Notebook →

Metabolic reprogramming in neurodegenerative disease - Rich Analysis Notebook

FDG-PET glucose metabolism analysis, metabolic gene expression profiling, therapeutic intervention modeling (ketogenic diet, GLP-1 agonists, metformin).

📊 Metabolic reprogramming in neurodegenerative disease (neurodegeneration)
Created: 2026-04-02
View Notebook →

Microglial subtypes in neurodegeneration friend vs foe - Rich Analysis Notebook

Five-state microglial classification across AD, PD, ALS. t-SNE visualization, protective vs harmful scoring, pharmacological target ranking.

📊 Microglial subtypes in neurodegeneration — friend vs foe (neuroscience)
Created: 2026-04-02
View Notebook →

Mitochondrial transfer between astrocytes and neurons - Rich Analysis Notebook

Enhanced notebook with gene expression, pathway enrichment, and statistical analysis for: What are the mechanisms underlying mitochondrial transfer between astrocytes and neurons?

📊 Mitochondrial transfer between astrocytes and neurons (neurodegeneration)
Created: 2026-04-02
View Notebook →

Senescent cell clearance as neurodegeneration therapy - Analysis Notebook

Gene expression analysis notebook for Can senolytics targeting senescent cells slow neurodegeneration?

Aging Senolytics Therapeutics Senescent Cells
CDKN2A CDKN1A TP53 RB1 BCL2
📊 Senescent cell clearance as neurodegeneration therapy (neurodegeneration)
Created: 2026-04-02
View Notebook →

CRISPR-based therapeutic approaches for neurodegenerative diseases - Analysis Notebook

Gene expression analysis notebook for Which CRISPR approaches are most promising for neurodegeneration?

CAS9 HTT SOD1 APP PSEN1
📊 CRISPR-based therapeutic approaches for neurodegenerative diseases (neurodegeneration)
Created: 2026-04-02
View Notebook →

TREM2 agonism vs antagonism in DAM microglia - Analysis Notebook

Gene expression analysis notebook for Should TREM2 be agonized or antagonized for AD therapy?

TREM2 TYROBP SYK PLCG2 ABI3
📊 TREM2 agonism vs antagonism in DAM microglia (neurodegeneration)
Created: 2026-04-02
View Notebook →

Gene expression changes in aging mouse brain - Analysis Notebook

Gene expression analysis notebook for Which aging gene changes predict neurodegeneration?

GFAP VIM C3 C1QA C1QB
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-02
View Notebook →

Neuroinflammation resolution mechanisms and pro-resolving mediators - Rich Analysis Notebook

Enhanced notebook with gene expression, pathway enrichment, and statistical analysis for: What are the mechanisms underlying neuroinflammation resolution mechanisms and pro-resolving mediato

📊 Neuroinflammation resolution mechanisms and pro-resolving mediators (neurodegeneration)
Created: 2026-04-02
View Notebook →

APOE4 structural biology and therapeutic targeting strategies - Rich Analysis Notebook

Enhanced notebook with gene expression, pathway enrichment, and statistical analysis for: What are the mechanisms underlying apoe4 structural biology and therapeutic targeting strategies?

📊 APOE4 structural biology and therapeutic targeting strategies (neurodegeneration)
Created: 2026-04-02
View Notebook →

Tau propagation mechanisms and therapeutic interception points - Rich Analysis Notebook

Enhanced notebook with gene expression, pathway enrichment, and statistical analysis for: Investigate prion-like spreading of tau pathology through connected brain regions, focusing on trans

Tau Protein Propagation Alzheimer's Therapeutics
📊 Tau propagation mechanisms and therapeutic interception points (neurodegeneration)
Created: 2026-04-02
View Notebook →

Circuit-Level Neural Dynamics in Neurodegeneration

Analyze circuit-level changes in neurodegeneration using Allen Institute Neural Dynamics data. Focus on how ion channel dysfunction and synaptic failure drive progressive circuit collapse in AD, PD, a

Allen Institute Neural Dynamics Circuit Analysis Neurodegeneration
📊 Circuit-level neural dynamics in neurodegeneration (neuroscience)
Created: 2026-04-02
View Notebook →

Epigenetic reprogramming in aging neurons - Rich Analysis Notebook

Executed notebook with gene expression plots, pathway enrichment, radar charts, and statistical tests for: Investigate mechanisms of epigenetic reprogramming in aging neurons...

Aging Epigenetics Gene Expression Neurodegeneration
📊 Epigenetic reprogramming in aging neurons (neurodegeneration)
Created: 2026-04-02
View Notebook →

Neuroinflammation resolution mechanisms and pro-resolving mediators - Rich Analysis Notebook

Enhanced notebook with gene expression, pathway enrichment, and statistical analysis for: What are the mechanisms underlying neuroinflammation resolution mechanisms and pro-resolving mediato

Neuroinflammation Immune Response Therapeutics
📊 Neuroinflammation resolution mechanisms and pro-resolving mediators (neurodegeneration)
Created: 2026-04-02
View Notebook →

APOE4 structural biology and therapeutic targeting strategies - Rich Analysis Notebook

Enhanced notebook with gene expression, pathway enrichment, and statistical analysis for: What are the mechanisms underlying apoe4 structural biology and therapeutic targeting strategies?

APOE4 Structural Biology Therapeutics Alzheimer's
📊 APOE4 structural biology and therapeutic targeting strategies (neurodegeneration)
Created: 2026-04-02
View Notebook →

TREM2 agonism vs antagonism in DAM microglia

Analysis ID: SDA-2026-04-01-gap-001

knowledge-gap microglia neurodegeneration
📊 TREM2 agonism vs antagonism in DAM microglia (neurodegeneration)
Created: 2026-04-01
View Notebook →

Selective vulnerability of entorhinal cortex layer II neurons in AD

Analysis ID: SDA-2026-04-01-gap-004

knowledge-gap neurodegeneration statistics
📊 Selective vulnerability of entorhinal cortex layer II neurons in AD (neurodegeneration)
Created: 2026-04-01
View Notebook →

4R-tau strain-specific spreading patterns in PSP vs CBD

Analysis ID: SDA-2026-04-01-gap-005

knowledge-gap microglia neurodegeneration statistics
📊 4R-tau strain-specific spreading patterns in PSP vs CBD (neurodegeneration)
Created: 2026-04-01
View Notebook →

TDP-43 phase separation therapeutics for ALS-FTD — Gene Expression & Pathway Analysis

Analysis ID: SDA-2026-04-01-gap-006 Date: 2026-04-03 Focus: phase separation dynamics and RNA-protein granule pathology

gene-expression neurodegeneration statistics
📊 TDP-43 phase separation therapeutics for ALS-FTD (neurodegeneration)
Created: 2026-04-01
View Notebook →

TDP-43 phase separation therapeutics for ALS-FTD — Statistical Deep Dive

Analysis ID: SDA-2026-04-01-gap-006 Date: 2026-04-03

gene-expression neurodegeneration statistics
📊 TDP-43 phase separation therapeutics for ALS-FTD (neurodegeneration)
Created: 2026-04-01
View Notebook →

TDP-43 phase separation therapeutics for ALS-FTD

Analysis ID: SDA-2026-04-01-gap-006 Domain: neurodegeneration Status: completed Date: 2026-04-01

neurodegeneration statistics
📊 TDP-43 phase separation therapeutics for ALS-FTD (neurodegeneration)
Created: 2026-04-01
View Notebook →

Astrocyte reactivity subtypes in neurodegeneration

What are the mechanisms underlying astrocyte reactivity subtypes in neurodegeneration?

epigenetics gene-expression neurodegeneration statistics
📊 Astrocyte reactivity subtypes in neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Blood-brain barrier transport mechanisms for antibody therapeutics

What are the mechanisms underlying blood-brain barrier transport mechanisms for antibody therapeutics?

gene-expression neurodegeneration statistics
📊 Blood-brain barrier transport mechanisms for antibody therapeutics (neurodegeneration)
Created: 2026-04-01
View Notebook →

Microglia-astrocyte crosstalk amplification loops in neurodegeneration — Gene Expression & Pathway Analysis

Analysis ID: SDA-2026-04-01-gap-009 Date: 2026-04-03 Focus: glial crosstalk amplification loops in neuroinflammation

gene-expression microglia neurodegeneration neuroinflammation statistics
📊 Microglia-astrocyte crosstalk amplification loops in neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Microglia-astrocyte crosstalk amplification loops in neurodegeneration — Statistical Deep Dive

Analysis ID: SDA-2026-04-01-gap-009 Date: 2026-04-03

gene-expression microglia neurodegeneration neuroinflammation statistics
📊 Microglia-astrocyte crosstalk amplification loops in neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Microglia-astrocyte crosstalk amplification loops in neurodegeneration

What are the mechanisms underlying microglia-astrocyte crosstalk amplification loops in neurodegeneration?

gene-expression microglia neurodegeneration statistics
📊 Microglia-astrocyte crosstalk amplification loops in neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

APOE4 Structural Biology and Therapeutic Targeting Strategies

What are the structural mechanisms underlying APOE4 pathogenicity and how can they be exploited for therapeutic intervention?

gene-expression neurodegeneration statistics
📊 APOE4 structural biology and therapeutic targeting strategies (neurodegeneration)
Created: 2026-04-01
View Notebook →

Autophagy-lysosome pathway convergence across neurodegenerative diseases — Gene Expression & Pathway Analysis

Analysis ID: SDA-2026-04-01-gap-011 Date: 2026-04-03 Focus: autophagy-lysosome convergence across neurodegenerative diseases

gene-expression neurodegeneration statistics
📊 Autophagy-lysosome pathway convergence across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-01
View Notebook →

Autophagy-lysosome pathway convergence across neurodegenerative diseases — Statistical Deep Dive

Analysis ID: SDA-2026-04-01-gap-011 Date: 2026-04-03

gene-expression neurodegeneration statistics
📊 Autophagy-lysosome pathway convergence across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-01
View Notebook →

Autophagy-lysosome pathway convergence across neurodegenerative diseases

What are the mechanisms underlying autophagy-lysosome pathway convergence across neurodegenerative diseases?

gene-expression neurodegeneration statistics
📊 Autophagy-lysosome pathway convergence across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-01
View Notebook →

Digital biomarkers and AI-driven early detection of neurodegeneration

What are the mechanisms underlying digital biomarkers and ai-driven early detection of neurodegeneration?

biomarkers gene-expression neurodegeneration statistics
📊 Digital biomarkers and AI-driven early detection of neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Senolytic therapy for age-related neurodegeneration

What are the mechanisms underlying senolytic therapy for age-related neurodegeneration?

gene-expression neurodegeneration senescence statistics
📊 Senolytic therapy for age-related neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Neuroinflammation Resolution Mechanisms and Pro-Resolving Mediators

How do specialized pro-resolving mediators (SPMs) resolve neuroinflammation, and can their pathways be therapeutically enhanced?

gene-expression microglia neurodegeneration neuroinflammation senescence
📊 Neuroinflammation resolution mechanisms and pro-resolving mediators (neurodegeneration)
Created: 2026-04-01
View Notebook →

Gut Microbiome Dysbiosis and Parkinson's Disease via the Gut-Brain Axis

Real Forge-powered analysis: PubMed search, STRING PPI, Reactome pathways, gene annotations for gut-brain axis / Parkinson's disease research.

showcase forge-tools gene-expression neurodegeneration
📊 What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? (neurodegeneration)
Created: 2026-04-01
View Notebook →

What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis?

What are the mechanisms underlying what are the mechanisms by which gut microbiome dysbiosis influences parkinson's disease pathogenesis through the gut-brain axis??

gene-expression neurodegeneration statistics
📊 What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? (neurodegeneration)
Created: 2026-04-01
View Notebook →

Mitochondrial transfer between neurons and glia

Analysis ID: SDA-2026-04-01-gap-20260401231108

gene-expression microglia neurodegeneration statistics
📊 Mitochondrial transfer between neurons and glia (neurodegeneration)
Created: 2026-04-01
View Notebook →

Protein aggregation cross-seeding across neurodegenerative diseases

What are the mechanisms underlying protein aggregation cross-seeding across neurodegenerative diseases?

gene-expression neurodegeneration statistics
📊 Protein aggregation cross-seeding across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-01
View Notebook →

Mechanistic role of APOE in neurodegeneration

SciDEX Analysis | ID: SDA-2026-04-01-gap-auto-fd6b1635d9

lipid-rafts neurodegeneration statistics
Created: 2026-04-01

Sleep disruption as cause and consequence of neurodegeneration — Gene Expression & Pathway Analysis

Analysis ID: SDA-2026-04-01-gap-v2-18cf98ca Date: 2026-04-03 Focus: bidirectional relationship between sleep disruption and neurodegeneration

gene-expression neurodegeneration statistics
📊 Sleep disruption as cause and consequence of neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Sleep disruption as cause and consequence of neurodegeneration — Statistical Deep Dive

Analysis ID: SDA-2026-04-01-gap-v2-18cf98ca Date: 2026-04-03

gene-expression microglia neurodegeneration statistics tau
📊 Sleep disruption as cause and consequence of neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Sleep Disruption as Cause and Consequence of Neurodegeneration

How do sleep disruptions both drive and result from neurodegenerative disease processes, and what therapeutic opportunities exist in this bidirectional relationship?

gene-expression microglia neurodegeneration statistics tau
📊 Sleep disruption as cause and consequence of neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

RNA binding protein dysregulation across ALS FTD and AD

Analysis ID: SDA-2026-04-01-gap-v2-68d9c9c1

gene-expression neurodegeneration statistics
📊 RNA binding protein dysregulation across ALS FTD and AD (neurodegeneration)
Created: 2026-04-01
View Notebook →

Synaptic pruning by microglia in early AD — Gene Expression & Pathway Analysis

Analysis ID: SDA-2026-04-01-gap-v2-691b42f1 Date: 2026-04-03 Focus: complement-mediated synaptic elimination in early Alzheimer pathology

gene-expression microglia neurodegeneration statistics
📊 Synaptic pruning by microglia in early AD (neurodegeneration)
Created: 2026-04-01
View Notebook →

Synaptic pruning by microglia in early AD — Statistical Deep Dive

Analysis ID: SDA-2026-04-01-gap-v2-691b42f1 Date: 2026-04-03

gene-expression microglia neurodegeneration statistics
📊 Synaptic pruning by microglia in early AD (neurodegeneration)
Created: 2026-04-01
View Notebook →

Synaptic pruning by microglia in early AD

Analysis ID: SDA-2026-04-01-gap-v2-691b42f1

gene-expression microglia neurodegeneration statistics
📊 Synaptic pruning by microglia in early AD (neurodegeneration)
Created: 2026-04-01
View Notebook →

Mitochondrial transfer between astrocytes and neurons

Analysis ID: SDA-2026-04-01-gap-v2-89432b95

gene-expression neurodegeneration
📊 Mitochondrial transfer between astrocytes and neurons (neurodegeneration)
Created: 2026-04-01
View Notebook →

Epigenetic clocks and biological aging in neurodegeneration

What are the mechanisms underlying epigenetic clocks and biological aging in neurodegeneration?

epigenetics gene-expression neurodegeneration statistics
📊 Epigenetic clocks and biological aging in neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Perivascular Spaces and Glymphatic Clearance Failure in AD

How do perivascular space dysfunction and glymphatic clearance failure contribute to Alzheimer's disease pathogenesis?

gene-expression neurodegeneration statistics
📊 Perivascular spaces and glymphatic clearance failure in AD (neurodegeneration)
Created: 2026-04-01
View Notebook →

TREM2 agonism vs antagonism in DAM microglia

Analysis ID: SDA-2026-04-01-gap-001 Date: 2026-04-01 Domain: neurodegeneration Key Hypotheses: - TREM2-Dependent Microglial Senescence Transition (score: 0.705) - Cell-Type Specific TREM

SEA-AD gene-expression hypothesis-analysis knowledge-gap microglia
📊 TREM2 agonism vs antagonism in DAM microglia (neurodegeneration)
Created: 2026-04-01
View Notebook →

Selective vulnerability of entorhinal cortex layer II neurons in AD

Analysis ID: SDA-2026-04-01-gap-004 Date: 2026-04-01 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 83

SEA-AD gene-expression hypothesis-analysis knowledge-gap microglia
📊 Selective vulnerability of entorhinal cortex layer II neurons in AD (neurodegeneration)
Created: 2026-04-01
View Notebook →

4R-tau strain-specific spreading patterns in PSP vs CBD

Analysis ID: SDA-2026-04-01-gap-005 Date: 2026-04-01 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 112

SEA-AD gene-expression hypothesis-analysis knowledge-gap microglia
📊 4R-tau strain-specific spreading patterns in PSP vs CBD (neurodegeneration)
Created: 2026-04-01
View Notebook →

TDP-43 phase separation therapeutics for ALS-FTD

What are the mechanisms underlying tdp-43 phase separation therapeutics for als-ftd?

gene-expression hypothesis-analysis neurodegeneration statistics
📊 TDP-43 phase separation therapeutics for ALS-FTD (neurodegeneration)
Created: 2026-04-01
View Notebook →

Astrocyte reactivity subtypes in neurodegeneration

Analysis ID: SDA-2026-04-01-gap-007 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 20

SEA-AD epigenetics gene-expression hypothesis-analysis microglia
📊 Astrocyte reactivity subtypes in neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Blood-brain barrier transport mechanisms for antibody therapeutics

Analysis ID: SDA-2026-04-01-gap-008 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 20

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Blood-brain barrier transport mechanisms for antibody therapeutics (neurodegeneration)
Created: 2026-04-01
View Notebook →

Microglia-astrocyte crosstalk amplification loops in neurodegeneration

Analysis ID: SDA-2026-04-01-gap-009 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 20

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Microglia-astrocyte crosstalk amplification loops in neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

APOE4 structural biology and therapeutic targeting strategies

Analysis ID: SDA-2026-04-01-gap-010 Date: 2026-04-01 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 81

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 APOE4 structural biology and therapeutic targeting strategies (neurodegeneration)
Created: 2026-04-01
View Notebook →

Autophagy-lysosome pathway convergence across neurodegenerative diseases

What are the mechanisms underlying autophagy-lysosome pathway convergence across neurodegenerative diseases?

gene-expression hypothesis-analysis neurodegeneration statistics
📊 Autophagy-lysosome pathway convergence across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-01
View Notebook →

Digital biomarkers and AI-driven early detection of neurodegeneration

Analysis ID: SDA-2026-04-01-gap-012 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 20

SEA-AD biomarkers gene-expression hypothesis-analysis microglia
📊 Digital biomarkers and AI-driven early detection of neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Senolytic therapy for age-related neurodegeneration

Analysis ID: SDA-2026-04-01-gap-013 Date: 2026-04-01 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 282

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Senolytic therapy for age-related neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis?

What are the mechanisms underlying what are the mechanisms by which gut microbiome dysbiosis influences parkinson's disease pathogenesis through the gut-brain axis??

gene-expression hypothesis-analysis neurodegeneration statistics
📊 What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? (neurodegeneration)
Created: 2026-04-01
View Notebook →

Mitochondrial transfer between neurons and glia

Analysis ID: SDA-2026-04-01-gap-20260401231108 Date: 2026-04-02 Domain: neurodegeneration Hypotheses Generated: 7 Knowledge Graph Edges: 0

SEA-AD gene-expression hypothesis-analysis microglia neurodegeneration
📊 Mitochondrial transfer between neurons and glia (neurodegeneration)
Created: 2026-04-01
View Notebook →

Mechanistic role of APOE in neurodegeneration

What are the mechanisms underlying mechanistic role of apoe in neurodegeneration?

gene-expression hypothesis-analysis lipid-rafts neurodegeneration statistics
📊 Mechanistic role of APOE in neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Lipid raft composition changes in synaptic neurodegeneration

Investigate how lipid raft composition (cholesterol metabolism, sphingolipids) changes in synaptic membranes during neurodegeneration and their mechanistic role in amyloid-beta processing and synapse

gene-expression hypothesis-analysis lipid-rafts neurodegeneration statistics
📊 Lipid raft composition changes in synaptic neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

Sleep disruption as cause and consequence of neurodegeneration

What are the mechanisms underlying sleep disruption as cause and consequence of neurodegeneration?

gene-expression hypothesis-analysis microglia neurodegeneration statistics
📊 Sleep disruption as cause and consequence of neurodegeneration (neurodegeneration)
Created: 2026-04-01
View Notebook →

RNA binding protein dysregulation across ALS FTD and AD

What are the mechanisms underlying rna binding protein dysregulation across als ftd and ad?

gene-expression hypothesis-analysis neurodegeneration statistics
📊 RNA binding protein dysregulation across ALS FTD and AD (neurodegeneration)
Created: 2026-04-01
View Notebook →

Synaptic pruning by microglia in early AD

What are the mechanisms underlying synaptic pruning by microglia in early ad?

gene-expression hypothesis-analysis microglia neurodegeneration statistics
📊 Synaptic pruning by microglia in early AD (neurodegeneration)
Created: 2026-04-01
View Notebook →

Perivascular spaces and glymphatic clearance failure in AD

What are the mechanisms underlying perivascular spaces and glymphatic clearance failure in ad?

gene-expression hypothesis-analysis neurodegeneration statistics
📊 Perivascular spaces and glymphatic clearance failure in AD (neurodegeneration)
Created: 2026-04-01
View Notebook →