Notebook Artifact Registry

Computational analysis artifacts linked to analyses and knowledge graph entities

AllAPOE4AgingAllen InstituteAlzheimer'sCRISPRCircuit AnalysisCross-Age AnalysisEpigeneticsGene ExpressionImmune ResponseMicrogliaMouse ModelNeural DynamicsNeurodegenerationNeuroinflammationProtein PropagationSEA-ADSenescent CellsSenolyticsStructural BiologyTauTherapeutics[]agingalzheimersanalysisartifactastrocytesautobiomarkerscell-typescidraftepigeneticsforge-toolsgene-editinggene-expressionhypothesis-analysisknowledge-gaplipid-raftsmicroglianeurodegenerationneuroinflammationneuronsnotebooksea-adsenescenceshowcasesingle-cellstatisticsstubtautranscriptomicswalkthrough

🌟 Spotlight Notebooks

Mitochondrial Dysfunction as a Driver of Neurodegeneration

How does mitochondrial dysfunction drive neurodegeneration across AD, PD, and ALS? Characterize PINK1/Parkin mitophagy pathway, mtDNA damage, ETC complex activity, and ROS generati

[]
Created: 2026-04-12
View Notebook →

Tau Pathology Propagation in Tauopathies — Mechanistic Dissection

How does misfolded tau spread through the brain in tauopathies? Characterize prion-like propagation mechanisms, cell-to-cell transfer, and the role of MAPT mutations, ApoE genotype

[]
Created: 2026-04-12
View Notebook →

Neuroinflammation and microglial priming in early Alzheimer's Disease — Analysis Notebook

Mechanistic links between early microglial priming states, neuroinflammatory signaling, and AD progression. Forge-powered analysis with 14 hypotheses, 105 KG edges, and PubMed cita

showcase forge-tools neuroinflammation neurodegeneration
📊 Neuroinflammation and microglial priming in early Alzheimer's Disease
Created: 2026-04-11
View Notebook →

Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability — Analysis Notebook

Forge-powered analysis: 28 hypotheses, 216 KG edges, PubMed + STRING + Open Targets + ClinVar. 10 code cells, 5 plots.

showcase forge-tools transcriptomics neurodegeneration
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability
Created: 2026-04-11
View Notebook →

CRISPR-based therapeutic approaches for neurodegenerative diseases — Analysis Notebook

CRISPR-based therapeutic approaches for neurodegenerative diseases (Alzheimer, Parkinson, Huntington). Forge-powered analysis with 14 hypotheses, 431 KG edges, and PubMed citations

showcase forge-tools gene-editing neurodegeneration
📊 CRISPR-based therapeutic approaches for neurodegenerative diseases
Created: 2026-04-11
View Notebook →

All Notebooks (70) (filtered by: auto)

Which specific post-translational modifications on pathological tau create druggable epitopes absent in physiological tau? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-09-gap-debate-20260409-201742-1e8eb3bd. The debate mentioned tau PTM targeting but did not identify which modifications are both disease-specific an

stub auto ci
📊 Which specific post-translational modifications on pathological tau create druggable epitopes absent in physiological tau? (neurodegeneration)
Created: 2026-04-12
View Notebook →

Do tau-containing vesicles exhibit unique surface glycosylation patterns that distinguish them from normal vesicles? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-09-gap-debate-20260409-201742-d279750b. The debate proposed targeting vesicle surface glycans but acknowledged no published data demonstrates unique

stub auto ci
📊 Do tau-containing vesicles exhibit unique surface glycosylation patterns that distinguish them from normal vesicles? (neurodegeneration)
Created: 2026-04-12
View Notebook →

What are the minimal structural requirements for HSP70/HSP90 inhibitors to achieve tau-selectivity over essential cellular functions? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-09-gap-debate-20260409-201742-5407d57d. The debate highlighted broad cellular toxicity of existing HSP inhibitors but did not resolve how to enginee

stub auto ci
📊 What are the minimal structural requirements for HSP70/HSP90 inhibitors to achieve tau-selectivity over essential cellular functions? (drug discovery)
Created: 2026-04-12
View Notebook →

Human connectome alterations and network-level dysfunction in Alzheimer disease — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-frontier-connectomics-84acb35a. How do structural and functional connectivity changes in the human brain connectome drive cognitive decline in Al

stub auto ci
📊 Human connectome alterations and network-level dysfunction in Alzheimer disease (neurodegeneration)
Created: 2026-04-12
View Notebook →

Quantitative proteomics of the aging synapse in early Alzheimer disease — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-frontier-proteomics-1c3dba72. What are the critical protein expression changes and post-translational modifications (phosphorylation, ubiquitinat

stub auto ci
📊 Quantitative proteomics of the aging synapse in early Alzheimer disease (neurodegeneration)
Created: 2026-04-12
View Notebook →

Can nanobodies achieve selective membrane penetration into tau-containing vesicles without affecting normal cellular vesicles? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-09-gap-debate-20260409-201742-ca7016f1. The debate identified vesicle accessibility as a major concern for nanobody approaches but provided no evide

stub auto ci
📊 Can nanobodies achieve selective membrane penetration into tau-containing vesicles without affecting normal cellular vesicles? (molecular biology)
Created: 2026-04-12
View Notebook →

Immune atlas neuroinflammation analysis in neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-03-gap-immune-atlas-neuroinflam-20260402. Comprehensive analysis of immune cell subtypes in neurodegeneration: microglia subtypes (DAM, homeostatic,

analysis auto ci
📊 Immune atlas neuroinflammation analysis in neurodegeneration (Neuroinflammation)
Created: 2026-04-12
View Notebook →

What is the actual quantitative contribution of FcRn-mediated transcytosis to BBB antibody transport in humans? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-12-gap-debate-20260410-112908-13c403ee. The debate revealed conflicting estimates ranging from <5% to 20% for FcRn's role in BBB transport, with spe

analysis auto ci
📊 What is the actual quantitative contribution of FcRn-mediated transcytosis to BBB antibody transport in humans? (neuropharmacology)
Created: 2026-04-12
View Notebook →

Systemic immune profiling and peripheral immune contributions to neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-frontier-immunomics-e6f97b29. How do peripheral immune system alterations influence CNS pathology and neurodegeneration in Alzheimer disease? Exa

analysis auto ci
📊 Systemic immune profiling and peripheral immune contributions to neurodegeneration (neurodegeneration)
Created: 2026-04-12
View Notebook →

What are the optimal timing windows for TREM2 agonism vs antagonism across disease progression stages? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-11-gap-debate-20260410-112636-141592ba. The debate highlighted that TREM2 therapeutic targeting remains contested across disease stages, but no clea

draft auto ci
📊 What are the optimal timing windows for TREM2 agonism vs antagonism across disease progression stages? (neurodegeneration)
Created: 2026-04-12

How can CRISPR systems achieve persistent therapeutic effects while avoiding chronic immune responses to Cas proteins in the CNS? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-11-gap-debate-20260410-112625-c44578b5. The debate highlighted that long-term CRISPR expression triggers immune responses, but epigenetic therapies

draft auto ci
📊 How can CRISPR systems achieve persistent therapeutic effects while avoiding chronic immune responses to Cas proteins in the CNS? (gene therapy)
Created: 2026-04-12

Can P16INK4A expression reliably distinguish harmful from beneficial senescent microglia in neurodegeneration? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-11-gap-debate-20260410-112619-9c3c13d2. The debate proposed P16INK4A-guided targeting but the Skeptic noted microglia exist in complex activation st

draft auto ci
📊 Can P16INK4A expression reliably distinguish harmful from beneficial senescent microglia in neurodegeneration? (neurodegeneration)
Created: 2026-04-12

Which neural cell types exhibit the most pronounced gene expression alterations in neurodegeneration? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-11-gap-debate-20260410-112336-ccdef571. The debate generated therapeutic hypotheses targeting different cell types but never resolved the fundamenta

draft auto ci
📊 Which neural cell types exhibit the most pronounced gene expression alterations in neurodegeneration? (neurodegeneration)
Created: 2026-04-11

Does reduced Prevotellaceae abundance cause PD pathology or result from it? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-11-gap-debate-20260410-111558-f9487fea. Does reduced Prevotellaceae abundance cause PD pathology or result from it?

analysis auto ci
📊 Does reduced Prevotellaceae abundance cause PD pathology or result from it? (neurodegeneration)
Created: 2026-04-11
View Notebook →

Lipid metabolism dysregulation and membrane integrity in Alzheimer disease — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-frontier-lipidomics-dcdbc360. How do alterations in brain lipid metabolism—including gangliosides, phospholipids, cholesterol transport, and sphi

analysis auto ci
📊 Lipid metabolism dysregulation and membrane integrity in Alzheimer disease (neurodegeneration)
Created: 2026-04-11
View Notebook →

Senescent cell clearance as neurodegeneration therapy — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-gap-senescent-clearance-neuro. Investigate the therapeutic potential of clearing senescent cells (senolytics) to slow or reverse neurodegeneratio

analysis auto ci
📊 Senescent cell clearance as neurodegeneration therapy (neurodegeneration)
Created: 2026-04-11
View Notebook →

Cell type vulnerability in Alzheimer's Disease (SEA-AD data) — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-03-gap-seaad-20260402025452. What cell types are most vulnerable in Alzheimers Disease based on SEA-AD transcriptomic data? Use Allen Brain Cell Atl

analysis auto ci
📊 Cell type vulnerability in Alzheimer's Disease (SEA-AD data) (neurodegeneration)
Created: 2026-04-11
View Notebook →

Epigenetic reprogramming in aging neurons — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-gap-epigenetic-reprog-b685190e. Investigate mechanisms of epigenetic reprogramming in aging neurons, including DNA methylation changes, histone m

analysis auto ci
📊 Epigenetic reprogramming in aging neurons (neurodegeneration)
Created: 2026-04-11
View Notebook →

SEA-AD Single-Cell Analysis: Cell-Type Vulnerability in Alzheimer's Disease — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-analysis_sea_ad_001. What are the cell-type specific vulnerability mechanisms in Alzheimer's disease based on SEA-AD single-cell data?

analysis auto ci
📊 SEA-AD Single-Cell Analysis: Cell-Type Vulnerability in Alzheimer's Disease (neurodegeneration)
Created: 2026-04-11
View Notebook →

Does SYK activation provide neuroprotection or exacerbate neuroinflammation in established Alzheimer's disease? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-11-gap-debate-20260410-111113-052488a8. The debate revealed fundamental uncertainty about whether enhancing TYROBP-SYK signaling would be beneficial

draft auto ci
📊 Does SYK activation provide neuroprotection or exacerbate neuroinflammation in established Alzheimer's disease? (neurodegeneration)
Created: 2026-04-11

What neural circuits encode and maintain multi-generational migratory route memory? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-08-gap-pubmed-20260406-062218-5c7f15f4. The paper describes memory-based migration routes maintained across generations but doesn't explain the neur

analysis auto ci
📊 What neural circuits encode and maintain multi-generational migratory route memory? (spatial memory)
Created: 2026-04-11
View Notebook →

Why do clinical manifestations overlap despite distinct underlying etiologies in immune-mediated myelopathies? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-08-gap-pubmed-20260406-062111-db808ee9. The abstract notes that clinical presentations overlap across different myelopathy etiologies, but the mecha

analysis auto ci
📊 Why do clinical manifestations overlap despite distinct underlying etiologies in immune-mediated myelopathies? (neuroinflammation)
Created: 2026-04-11
View Notebook →

Which specific metabolic pathways in APOE4+ microglia are most therapeutically tractable? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-08-gap-debate-20260406-062033-fecb8755. While APOE4 disrupts microglial metabolism broadly, the debate didn't identify which specific disrupted path

analysis auto ci
📊 Which specific metabolic pathways in APOE4+ microglia are most therapeutically tractable? (neurodegeneration)
Created: 2026-04-11
View Notebook →

Neuroinflammation and microglial priming in early AD — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-gap-neuroinflammation-microglial-20260404. How does microglial priming contribute to early Alzheimer's disease pathology? Focus on the mechanisms

analysis auto ci
📊 Neuroinflammation and microglial priming in early AD (neurodegeneration)
Created: 2026-04-11
View Notebook →

Tau propagation mechanisms and therapeutic interception points — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-gap-tau-prop-20260402003221. Investigate prion-like spreading of tau pathology through connected brain regions, focusing on trans-synaptic transf

analysis auto ci
📊 Tau propagation mechanisms and therapeutic interception points (neurodegeneration)
Created: 2026-04-11
View Notebook →

Which cell types show the most significant expression changes for neurodegeneration genes in SEA-AD cohorts? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-03-gap-debate-20260403-222543-20260402. The debate mentioned gene expression profiling but did not specify which neural cell populations (neurons, m

analysis auto ci
📊 Which cell types show the most significant expression changes for neurodegeneration genes in SEA-AD cohorts? (neurodegeneration)
Created: 2026-04-11
View Notebook →

Does TFEB dysfunction cause neurodegeneration or represent a compensatory response to primary pathology? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-03-gap-debate-20260403-222617-8eb5bdbc. The debate highlighted TFEB's role in mitochondrial-lysosomal coupling but couldn't resolve causation vs cor

analysis auto ci
📊 Does TFEB dysfunction cause neurodegeneration or represent a compensatory response to primary pathology? (neurodegeneration)
Created: 2026-04-11
View Notebook →

Circuit-level neural dynamics in neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-03-26abc5e5f9f2. Analyze circuit-level changes in neurodegeneration using Allen Institute Neural Dynamics data. Focus on: (1) hippocampal circuit di

analysis auto ci
📊 Circuit-level neural dynamics in neurodegeneration (neuroscience)
Created: 2026-04-11
View Notebook →

Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-03-gap-seaad-v4-20260402065846. What cell types are most vulnerable in Alzheimers Disease based on SEA-AD transcriptomic data from the Allen Brain C

analysis auto ci
📊 Cell type vulnerability in Alzheimers Disease (SEA-AD transcriptomic data) (neurodegeneration)
Created: 2026-04-11
View Notebook →

Cell type vulnerability in Alzheimer's Disease (SEA-AD data - v2) — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-03-gap-seaad-v2-20260402032945. What cell types are most vulnerable in Alzheimer's Disease based on SEA-AD transcriptomic data from the Allen Brain

analysis auto ci
📊 Cell type vulnerability in Alzheimer's Disease (SEA-AD data - v2) (neurodegeneration)
Created: 2026-04-11
View Notebook →

SEA-AD Gene Expression Profiling — Allen Brain Cell Atlas — Analysis Notebook

CI-generated notebook stub for analysis analysis-SEAAD-20260402. What are the cell-type specific expression patterns of key neurodegeneration genes in the Seattle Alzheimer's Disease Brain Cell Atlas?

analysis auto ci
📊 SEA-AD Gene Expression Profiling — Allen Brain Cell Atlas (neurodegeneration)
Created: 2026-04-11
View Notebook →

Extracellular vesicle biomarkers for early AD detection — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-02-gap-ev-ad-biomarkers. Extracellular vesicles (EVs), including exosomes and microvesicles, carry molecular cargo (proteins, miRNAs, lipids) from t

analysis auto ci
📊 Extracellular vesicle biomarkers for early AD detection (neurodegeneration)
Created: 2026-04-11
View Notebook →

Metabolic reprogramming in neurodegenerative disease — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-02-gap-v2-5d0e3052. How does metabolic reprogramming (glucose metabolism shifts, brain insulin resistance, ketone body utilization) affect neuronal

analysis auto ci
📊 Metabolic reprogramming in neurodegenerative disease (neurodegeneration)
Created: 2026-04-11
View Notebook →

Epigenetic clocks and biological aging in neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-v2-bc5f270e. Epigenetic clocks and biological aging in neurodegeneration

analysis auto ci
📊 Epigenetic clocks and biological aging in neurodegeneration (neurodegeneration)
Created: 2026-04-11
View Notebook →

Sleep disruption as cause and consequence of neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-v2-18cf98ca. Sleep disruption as cause and consequence of neurodegeneration

analysis auto ci
📊 Sleep disruption as cause and consequence of neurodegeneration (neurodegeneration)
Created: 2026-04-11
View Notebook →

Mitochondrial transfer between astrocytes and neurons — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-v2-89432b95. Mitochondrial transfer between astrocytes and neurons

analysis auto ci
📊 Mitochondrial transfer between astrocytes and neurons (neurodegeneration)
Created: 2026-04-11
View Notebook →

RNA binding protein dysregulation across ALS FTD and AD — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-v2-68d9c9c1. RNA binding protein dysregulation across ALS FTD and AD

analysis auto ci
📊 RNA binding protein dysregulation across ALS FTD and AD (neurodegeneration)
Created: 2026-04-11
View Notebook →

Perivascular spaces and glymphatic clearance failure in AD — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-v2-ee5a5023. Perivascular spaces and glymphatic clearance failure in AD

analysis auto ci
📊 Perivascular spaces and glymphatic clearance failure in AD (neurodegeneration)
Created: 2026-04-11
View Notebook →

Synaptic pruning by microglia in early AD — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-v2-691b42f1. Synaptic pruning by microglia in early AD

analysis auto ci
📊 Synaptic pruning by microglia in early AD (neurodegeneration)
Created: 2026-04-11
View Notebook →

Neuroinflammation resolution mechanisms and pro-resolving mediators — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-014. SPMs (resolvins, protectins, maresins) from omega-3s may promote inflammation resolution. Are resolution failures druggable?

analysis auto ci
📊 Neuroinflammation resolution mechanisms and pro-resolving mediators (neurodegeneration)
Created: 2026-04-11
View Notebook →

Digital biomarkers and AI-driven early detection of neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-012. Can speech, gait, retinal imaging, sleep, and smartphone data detect neurodegeneration 5-10 years before diagnosis?

analysis auto ci
📊 Digital biomarkers and AI-driven early detection of neurodegeneration (neurodegeneration)
Created: 2026-04-11
View Notebook →

Senolytic therapy for age-related neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-013. Senolytics targeting p16/p21+ senescent astrocytes and microglia may reduce SASP-driven neuroinflammation.

analysis auto ci
📊 Senolytic therapy for age-related neurodegeneration (neurodegeneration)
Created: 2026-04-11
View Notebook →

Autophagy-lysosome pathway convergence across neurodegenerative diseases — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-011. Multiple NDDs converge on autophagy-lysosome dysfunction. Are there universal therapeutic targets?

analysis auto ci
📊 Autophagy-lysosome pathway convergence across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-11
View Notebook →

Microglia-astrocyte crosstalk amplification loops in neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-009. Microglia activate astrocytes via IL-1alpha/TNF/C1q, and reactive astrocytes feed back to microglia via complement/chemokines.

analysis auto ci
📊 Microglia-astrocyte crosstalk amplification loops in neurodegeneration (neurodegeneration)
Created: 2026-04-11
View Notebook →

APOE4 structural biology and therapeutic targeting strategies — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-010. APOE4 differs from APOE3 by C112R causing domain interaction that alters lipid binding and amyloid clearance.

analysis auto ci
📊 APOE4 structural biology and therapeutic targeting strategies (neurodegeneration)
Created: 2026-04-11
View Notebook →

TDP-43 phase separation therapeutics for ALS-FTD — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-006. TDP-43 undergoes liquid-liquid phase separation that becomes pathological. Small molecules targeting phase separation properties could b

analysis auto ci
📊 TDP-43 phase separation therapeutics for ALS-FTD (neurodegeneration)
Created: 2026-04-11
View Notebook →

Astrocyte reactivity subtypes in neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-007. Astrocytes adopt A1 (neurotoxic) and A2 (neuroprotective) phenotypes, but recent single-cell data reveals far greater heterogeneity. Map

analysis auto ci
📊 Astrocyte reactivity subtypes in neurodegeneration (neurodegeneration)
Created: 2026-04-11
View Notebook →

4R-tau strain-specific spreading patterns in PSP vs CBD — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-005. PSP and CBD both involve 4R-tau but produce distinct neuropathological patterns (tufted astrocytes vs astrocytic plaques). Whether tau s

analysis auto ci
📊 4R-tau strain-specific spreading patterns in PSP vs CBD (neurodegeneration)
Created: 2026-04-11
View Notebook →

Selective vulnerability of entorhinal cortex layer II neurons in AD — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-004. Why do entorhinal cortex layer II stellate neurons die first in AD? Their unique electrophysiological properties, grid cell function, an

analysis auto ci
📊 Selective vulnerability of entorhinal cortex layer II neurons in AD (neurodegeneration)
Created: 2026-04-11
View Notebook →

Blood-brain barrier transport mechanisms for antibody therapeutics — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-008. Anti-amyloid antibodies (lecanemab, donanemab) have ~0.1% brain penetrance. Engineering improved BBB transcytosis via transferrin recept

analysis auto ci
📊 Blood-brain barrier transport mechanisms for antibody therapeutics (neurodegeneration)
Created: 2026-04-11
View Notebook →

Lipid raft composition changes in synaptic neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-01-gap-lipid-rafts-2026-04-01. Investigate how lipid raft composition (cholesterol metabolism, sphingolipids) changes in synaptic membranes during n

analysis auto ci
📊 Lipid raft composition changes in synaptic neurodegeneration (neurodegeneration)
Created: 2026-04-11
View Notebook →

GBA-Synuclein Loop: Therapeutic Strategies for Parkinson's Disease — Analysis Notebook

CI-generated notebook stub for analysis gba-pd. GBA-Synuclein Loop: Therapeutic Strategies for Parkinson's Disease?

analysis auto ci
📊 GBA-Synuclein Loop: Therapeutic Strategies for Parkinson's Disease (neurodegeneration)
Created: 2026-04-11
View Notebook →

Gut-Brain Axis Therapeutics for Alzheimer's Disease — Analysis Notebook

CI-generated notebook stub for analysis gut-brain-ad. Gut-Brain Axis Therapeutics for Alzheimer's Disease?

analysis auto ci
📊 Gut-Brain Axis Therapeutics for Alzheimer's Disease (neurodegeneration)
Created: 2026-04-11
View Notebook →

What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-20260401-225149. What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain

analysis auto ci
📊 What are the mechanisms by which gut microbiome dysbiosis influences Parkinson's disease pathogenesis through the gut-brain axis? (neurodegeneration)
Created: 2026-04-11
View Notebook →

Mitochondrial transfer between neurons and glia — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-20260401231108. Mitochondrial transfer between neurons and glia?

analysis auto ci
📊 Mitochondrial transfer between neurons and glia (neurodegeneration)
Created: 2026-04-11
View Notebook →

Protein aggregation cross-seeding across neurodegenerative diseases — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-9137255b. Protein aggregation cross-seeding across neurodegenerative diseases?

analysis auto ci
📊 Protein aggregation cross-seeding across neurodegenerative diseases (neurodegeneration)
Created: 2026-04-11
View Notebook →

Mechanistic role of APOE in neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-gap-auto-fd6b1635d9. Mechanistic role of APOE in neurodegeneration?

analysis auto ci
📊 Mechanistic role of APOE in neurodegeneration (neurodegeneration)
Created: 2026-04-11
View Notebook →

TREM2 Therapeutic Strategy Post-INVOKE-2 — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-001. What are the most promising therapeutic strategies for targeting TREM2 in Alzheimer's disease, given the INVOKE-2 failure?

analysis auto ci
📊 TREM2 Therapeutic Strategy Post-INVOKE-2 (neurodegeneration)
Created: 2026-04-11
View Notebook →

GBA-Synuclein Loop Therapeutics for PD — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-002. How to break the GBA-alpha-synuclein bidirectional loop for Parkinson's Disease therapy?

analysis auto ci
📊 GBA-Synuclein Loop Therapeutics for PD (neurodegeneration)
Created: 2026-04-11
View Notebook →

Gut-Brain Axis Therapeutics for AD — Analysis Notebook

CI-generated notebook stub for analysis sda-2026-04-01-003. Can gut-brain axis modulation prevent or slow Alzheimer's disease pathology?

analysis auto ci
📊 Gut-Brain Axis Therapeutics for AD (neurodegeneration)
Created: 2026-04-11
View Notebook →

Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-03-gap-aging-mouse-brain-v2-20260402. What gene expression changes in the aging mouse brain predict neurodegenerative vulnerability? Use Allen Aging

analysis auto ci
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-06
View Notebook →

How do disease-associated mutations in G3BP1 or its binding partners alter stress granule dynamics? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-06-gap-pubmed-20260406-041428-e14e6524. The study establishes G3BP1's role as a tunable switch for stress granule assembly, but doesn't address how

draft auto ci
📊 How do disease-associated mutations in G3BP1 or its binding partners alter stress granule dynamics? (neurodegeneration)
Created: 2026-04-06

Unable to extract research questions - transcript appears to be empty — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-gap-debate-20260403-222510-20260402. The provided transcript contains only speaker labels [Theorist] and [Synthesizer] with no actual debate cont

draft auto ci
📊 Unable to extract research questions - transcript appears to be empty (methodology)
Created: 2026-04-06
View Notebook →

Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-03-gap-aging-mouse-brain-20260402. What gene expression changes in the aging mouse brain predict neurodegenerative vulnerability? Use Allen Aging Mo

analysis auto ci
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability (neurodegeneration)
Created: 2026-04-06
View Notebook →

SEA-AD Single-Cell Analysis: Cell-Type Vulnerability in Alzheimer's Disease — Analysis Notebook

CI-generated notebook stub for analysis analysis_sea_ad_001. What are the cell-type specific vulnerability mechanisms in Alzheimer's disease based on SEA-AD single-cell data?

analysis auto ci
📊 SEA-AD Single-Cell Analysis: Cell-Type Vulnerability in Alzheimer's Disease (neurodegeneration)
Created: 2026-04-04
View Notebook →

APOE4-driven lipid metabolism dysregulation in astrocytes and its role in AD — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-gap-apoe4-lipid-metabolism. APOE4 is the strongest genetic risk factor for late-onset AD. How APOE4 specifically disrupts lipid homeostasis in as

draft auto ci
📊 APOE4-driven lipid metabolism dysregulation in astrocytes and its role in AD (neuroscience)
Created: 2026-04-04

epigenetic reprogramming aging neurons — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-gap-20260404-060512. epigenetic reprogramming aging neurons

draft auto ci
📊 epigenetic reprogramming aging neurons (neurodegeneration)
Created: 2026-04-04

Investigate prion-like spreading of tau pathology through connected brain regions — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-gap-20260404-052358. Investigate prion-like spreading of tau pathology through connected brain regions

draft auto ci
📊 Investigate prion-like spreading of tau pathology through connected brain regions (neurodegeneration)
Created: 2026-04-04

Astrocyte Reactivity Subtypes in Neurodegeneration — Analysis Notebook

CI-generated notebook stub for analysis astrocyte-subtypes. Analysis question not specified

analysis auto ci
📊 Astrocyte Reactivity Subtypes in Neurodegeneration (neurodegeneration)
Created: 2026-04-04
View Notebook →

Neuroinflammation and microglial priming in early Alzheimer's Disease - Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-gap-neuro-microglia-early-ad-20260404. Investigate the role of neuroinflammation and microglial priming in the earliest stages of Alzheimer's Dis

analysis auto ci
📊 Neuroinflammation and microglial priming in early Alzheimer's Disease (neurodegeneration)
Created: 2026-04-04
View Notebook →