Notebook Artifact Registry

Computational analysis artifacts linked to analyses and knowledge graph entities

AllAPOE4AgingAllen InstituteAlzheimer'sCRISPRCircuit AnalysisCross-Age AnalysisEpigeneticsGene ExpressionImmune ResponseMicrogliaMouse ModelNeural DynamicsNeurodegenerationNeuroinflammationProtein PropagationSEA-ADSenescent CellsSenolyticsStructural BiologyTauTherapeutics[]agingalzheimersanalysisartifactastrocytesautobiomarkerscell-typescidraftepigeneticsforge-toolsgene-editinggene-expressionhypothesis-analysisknowledge-gaplipid-raftsmicroglianeurodegenerationneuroinflammationneuronsnotebooksea-adsenescenceshowcasesingle-cellstatisticsstubtautranscriptomicswalkthrough

🌟 Spotlight Notebooks

Mitochondrial Dysfunction as a Driver of Neurodegeneration

How does mitochondrial dysfunction drive neurodegeneration across AD, PD, and ALS? Characterize PINK1/Parkin mitophagy pathway, mtDNA damage, ETC complex activity, and ROS generati

[]
Created: 2026-04-12
View Notebook →

Tau Pathology Propagation in Tauopathies — Mechanistic Dissection

How does misfolded tau spread through the brain in tauopathies? Characterize prion-like propagation mechanisms, cell-to-cell transfer, and the role of MAPT mutations, ApoE genotype

[]
Created: 2026-04-12
View Notebook →

Neuroinflammation and microglial priming in early Alzheimer's Disease — Analysis Notebook

Mechanistic links between early microglial priming states, neuroinflammatory signaling, and AD progression. Forge-powered analysis with 14 hypotheses, 105 KG edges, and PubMed cita

showcase forge-tools neuroinflammation neurodegeneration
📊 Neuroinflammation and microglial priming in early Alzheimer's Disease
Created: 2026-04-11
View Notebook →

Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability — Analysis Notebook

Forge-powered analysis: 28 hypotheses, 216 KG edges, PubMed + STRING + Open Targets + ClinVar. 10 code cells, 5 plots.

showcase forge-tools transcriptomics neurodegeneration
📊 Gene expression changes in aging mouse brain predicting neurodegenerative vulnerability
Created: 2026-04-11
View Notebook →

CRISPR-based therapeutic approaches for neurodegenerative diseases — Analysis Notebook

CRISPR-based therapeutic approaches for neurodegenerative diseases (Alzheimer, Parkinson, Huntington). Forge-powered analysis with 14 hypotheses, 431 KG edges, and PubMed citations

showcase forge-tools gene-editing neurodegeneration
📊 CRISPR-based therapeutic approaches for neurodegenerative diseases
Created: 2026-04-11
View Notebook →

All Notebooks (6) (filtered by: stub)

Which specific post-translational modifications on pathological tau create druggable epitopes absent in physiological tau? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-09-gap-debate-20260409-201742-1e8eb3bd. The debate mentioned tau PTM targeting but did not identify which modifications are both disease-specific an

stub auto ci
📊 Which specific post-translational modifications on pathological tau create druggable epitopes absent in physiological tau? (neurodegeneration)
Created: 2026-04-12
View Notebook →

Do tau-containing vesicles exhibit unique surface glycosylation patterns that distinguish them from normal vesicles? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-09-gap-debate-20260409-201742-d279750b. The debate proposed targeting vesicle surface glycans but acknowledged no published data demonstrates unique

stub auto ci
📊 Do tau-containing vesicles exhibit unique surface glycosylation patterns that distinguish them from normal vesicles? (neurodegeneration)
Created: 2026-04-12
View Notebook →

What are the minimal structural requirements for HSP70/HSP90 inhibitors to achieve tau-selectivity over essential cellular functions? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-09-gap-debate-20260409-201742-5407d57d. The debate highlighted broad cellular toxicity of existing HSP inhibitors but did not resolve how to enginee

stub auto ci
📊 What are the minimal structural requirements for HSP70/HSP90 inhibitors to achieve tau-selectivity over essential cellular functions? (drug discovery)
Created: 2026-04-12
View Notebook →

Human connectome alterations and network-level dysfunction in Alzheimer disease — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-frontier-connectomics-84acb35a. How do structural and functional connectivity changes in the human brain connectome drive cognitive decline in Al

stub auto ci
📊 Human connectome alterations and network-level dysfunction in Alzheimer disease (neurodegeneration)
Created: 2026-04-12
View Notebook →

Quantitative proteomics of the aging synapse in early Alzheimer disease — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-04-frontier-proteomics-1c3dba72. What are the critical protein expression changes and post-translational modifications (phosphorylation, ubiquitinat

stub auto ci
📊 Quantitative proteomics of the aging synapse in early Alzheimer disease (neurodegeneration)
Created: 2026-04-12
View Notebook →

Can nanobodies achieve selective membrane penetration into tau-containing vesicles without affecting normal cellular vesicles? — Analysis Notebook

CI-generated notebook stub for analysis SDA-2026-04-09-gap-debate-20260409-201742-ca7016f1. The debate identified vesicle accessibility as a major concern for nanobody approaches but provided no evide

stub auto ci
📊 Can nanobodies achieve selective membrane penetration into tau-containing vesicles without affecting normal cellular vesicles? (molecular biology)
Created: 2026-04-12
View Notebook →